KEGG   Enhydra lutris kenyoni (northern sea otter): 111159748
Entry
111159748         CDS       T05871                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member 1A
  KO
K03158  tumor necrosis factor receptor superfamily member 1A
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04010  MAPK signaling pathway
elk04060  Cytokine-cytokine receptor interaction
elk04061  Viral protein interaction with cytokine and cytokine receptor
elk04064  NF-kappa B signaling pathway
elk04071  Sphingolipid signaling pathway
elk04150  mTOR signaling pathway
elk04210  Apoptosis
elk04215  Apoptosis - multiple species
elk04217  Necroptosis
elk04380  Osteoclast differentiation
elk04668  TNF signaling pathway
elk04920  Adipocytokine signaling pathway
elk04931  Insulin resistance
elk04932  Non-alcoholic fatty liver disease
elk05010  Alzheimer disease
elk05014  Amyotrophic lateral sclerosis
elk05022  Pathways of neurodegeneration - multiple diseases
elk05132  Salmonella infection
elk05142  Chagas disease
elk05145  Toxoplasmosis
elk05152  Tuberculosis
elk05160  Hepatitis C
elk05163  Human cytomegalovirus infection
elk05164  Influenza A
elk05165  Human papillomavirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05170  Human immunodeficiency virus 1 infection
elk05171  Coronavirus disease - COVID-19
elk05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111159748
   04064 NF-kappa B signaling pathway
    111159748
   04668 TNF signaling pathway
    111159748
   04071 Sphingolipid signaling pathway
    111159748
   04150 mTOR signaling pathway
    111159748
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111159748
   04061 Viral protein interaction with cytokine and cytokine receptor
    111159748
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111159748
   04215 Apoptosis - multiple species
    111159748
   04217 Necroptosis
    111159748
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111159748
  09158 Development and regeneration
   04380 Osteoclast differentiation
    111159748
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111159748
   05014 Amyotrophic lateral sclerosis
    111159748
   05022 Pathways of neurodegeneration - multiple diseases
    111159748
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111159748
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    111159748
   04931 Insulin resistance
    111159748
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111159748
   05152 Tuberculosis
    111159748
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111159748
   05170 Human immunodeficiency virus 1 infection
    111159748
   05160 Hepatitis C
    111159748
   05171 Coronavirus disease - COVID-19
    111159748
   05164 Influenza A
    111159748
   05168 Herpes simplex virus 1 infection
    111159748
   05163 Human cytomegalovirus infection
    111159748
   05167 Kaposi sarcoma-associated herpesvirus infection
    111159748
   05165 Human papillomavirus infection
    111159748
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    111159748
   05142 Chagas disease
    111159748
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:elk04050]
    111159748
   04090 CD molecules [BR:elk04090]
    111159748
Cytokine receptors [BR:elk04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   111159748
CD molecules [BR:elk04090]
 Proteins
  111159748
SSDB
Motif
Pfam: TNFR_c6 Death Proton_antipo_N
Other DBs
NCBI-GeneID: 111159748
NCBI-ProteinID: XP_022378040
UniProt: A0A2Y9L9A0
LinkDB
Position
Unknown
AA seq 458 aa
MGLPTVPGLLLPLVLLALLVEIYPLRVMALVPHVRDREKRAVLCPQGKYIHPQDNSICCT
KCHKGTYLYKDCPGLGLDTDCRECENGTFTASENHLRQCLSCSKCRKEMNQVEISPCTVS
QDTVCGCRENQYRRYWGDTLFQCVNCSLCLNGTVHISCTEKQNTVCTCHAGFFLRDHECI
PCVHCKENTECTKLCLLPVEKVTVPQDPGTTVLLPLVIFFGICVLSFSIVLMCRYQRQMP
RFFSTVCGKLTPTKEGEPETLASVPGFSPTTGFSPTTGFSPIPGFSPIPNPTFTPRSVFT
PRDWSKLRAPSDSGEMAPPYQEAGPILTAAPASTPIPIPVQKWEDSTHSQRAEADPADPV
TLYAVVDGVPPSRWKEFVRRLGLSEHEIERLELQNGRCLREAHYSMLAAWRRRMPRREAT
LELLGRVLRDMDLLGCLEDIEEALCAPASLSPAPRLLR
NT seq 1377 nt   +upstreamnt  +downstreamnt
atgggcctccccaccgtgcctggcctgctgctgccactggtgctcctggccttgttggtg
gaaatataccccttaagggttatggcactggtccctcacgtcagggaccgggagaagaga
gctgttctgtgtccccaaggaaaatatattcaccctcaagataattccatttgctgtacg
aagtgccacaaagggacctacctgtacaaggactgtcccggcctggggctggacacagac
tgcagggaatgtgaaaacggcacctttacagcttcggagaaccacctcagacagtgcctc
agttgctccaaatgccgaaaagaaatgaaccaggtggagatttctccttgcactgtgtcc
caggacactgtgtgcggctgccgggagaaccagtaccggcgttactggggtgacaccctt
ttccagtgcgtgaactgcagcctctgcctcaatggcacagtgcacatctcctgcacagag
aaacagaacacagtgtgcacctgccacgcgggtttctttctaagagaccatgaatgcata
ccctgtgttcactgtaaggaaaacacagagtgcacaaagttgtgtcttctccctgtggaa
aaggttacggtccctcaggacccaggtaccacagtgctgttgcccctggtgatcttcttt
ggcatttgtgttttatccttctctattgttttaatgtgccgctaccaacggcagatgccc
aggttcttctccactgtttgtgggaaattgacacctacaaaggagggggagcctgagacc
ctggcctcggttccaggtttcagtcccaccacaggcttcagtcccaccacgggcttcagt
cccatcccgggcttcagtcccatccccaaccccaccttcacccccaggtccgtcttcacc
ccacgtgactggtctaagttaagggctccgtcagactctggagagatggccccaccctac
caggaggctggccccatcctcaccgcggctccagcctccacccccattcccatcccagtt
cagaagtgggaggacagcacgcacagtcagcgcgcagaagccgaccccgcggacccggtg
acgctgtatgccgtggtggacggcgtgcccccatcgcgctggaaggagtttgtgcgccgg
ctggggctgagcgagcacgagatcgagcggctggagctgcagaacgggcgctgcctgcgg
gaggcccactacagcatgctggcggcctggcggcggcgcatgccacggcgcgaggccacg
ctggagctgctgggccgcgtgctccgcgacatggacctgctgggctgcctggaggacatc
gaggaggcgctgtgtgccccagcctccctctcgccggcgccccgcctcctgcgatga

DBGET integrated database retrieval system