KEGG   Enhydra lutris kenyoni (northern sea otter): 111159768
Entry
111159768         CDS       T05871                                 

Definition
(RefSeq) BH3-interacting domain death agonist
  KO
K04726  BH3 interacting domain death agonist
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01524  Platinum drug resistance
elk04071  Sphingolipid signaling pathway
elk04115  p53 signaling pathway
elk04210  Apoptosis
elk04215  Apoptosis - multiple species
elk04217  Necroptosis
elk04650  Natural killer cell mediated cytotoxicity
elk04932  Non-alcoholic fatty liver disease
elk05010  Alzheimer disease
elk05014  Amyotrophic lateral sclerosis
elk05022  Pathways of neurodegeneration - multiple diseases
elk05152  Tuberculosis
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05162  Measles
elk05163  Human cytomegalovirus infection
elk05164  Influenza A
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05200  Pathways in cancer
elk05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    111159768
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111159768
   04215 Apoptosis - multiple species
    111159768
   04217 Necroptosis
    111159768
   04115 p53 signaling pathway
    111159768
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    111159768
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111159768
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111159768
   05014 Amyotrophic lateral sclerosis
    111159768
   05022 Pathways of neurodegeneration - multiple diseases
    111159768
  09166 Cardiovascular disease
   05416 Viral myocarditis
    111159768
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    111159768
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111159768
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111159768
   05161 Hepatitis B
    111159768
   05160 Hepatitis C
    111159768
   05164 Influenza A
    111159768
   05162 Measles
    111159768
   05168 Herpes simplex virus 1 infection
    111159768
   05163 Human cytomegalovirus infection
    111159768
   05167 Kaposi sarcoma-associated herpesvirus infection
    111159768
   05169 Epstein-Barr virus infection
    111159768
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    111159768
SSDB
Motif
Pfam: BID Bcl-2
Other DBs
NCBI-GeneID: 111159768
NCBI-ProteinID: XP_022378068
UniProt: A0A2Y9KY95
LinkDB
Position
Unknown
AA seq 195 aa
MDSKVSNGSGLQDECITNLLVFGFLQSYSDSNFHKELEVLGRELPVPAHLQEEQDDGLQT
DGNRCGHFLASEERDSQGQEEIIQDIARQLAKIGDDMDRSIHPGLVNNLATQFMNRRLSE
EDRRQRLTAALEQVMQTYPTDMEDEKTMLILAMFLAKKVADHTPSLLREVFRTTVNFINQ
NLFTYVRNLVRNEMD
NT seq 588 nt   +upstreamnt  +downstreamnt
atggattctaaggtcagcaatggttcaggcctccaggatgagtgcatcacgaacttgctg
gtgtttggcttcctccaaagctactccgactctaatttccacaaagagttggaggtcctg
ggccgggaactgcccgtgccagctcatctgcaggaggagcaagacgatgggctgcagaca
gacggcaaccgctgcggccatttcctggcaagtgaggagagagattctcagggtcaagag
gaaatcattcaggatatcgccaggcagctcgccaaaataggggacgatatggatcgcagc
atccacccaggactggtgaataacctggcaacacagttcatgaataggagactgtcggaa
gaagacagaaggcagcgcctcactgctgcgctggagcaggtcatgcagacttaccctaca
gacatggaggacgagaagaccatgctgatactggccatgttcttggccaaaaaggtggcc
gatcacacaccatccttgctccgtgaagtctttcgcacaacagtgaactttattaaccag
aacctgttcacctacgtgaggaacttagtaagaaatgagatggactga

DBGET integrated database retrieval system