KEGG   Enhydra lutris kenyoni (northern sea otter): 111159871
Entry
111159871         CDS       T05871                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 2A-like isoform X1
  KO
K06621  cyclin-dependent kinase inhibitor 2A
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01522  Endocrine resistance
elk01524  Platinum drug resistance
elk04110  Cell cycle
elk04115  p53 signaling pathway
elk04218  Cellular senescence
elk04934  Cushing syndrome
elk05163  Human cytomegalovirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05200  Pathways in cancer
elk05203  Viral carcinogenesis
elk05206  MicroRNAs in cancer
elk05212  Pancreatic cancer
elk05214  Glioma
elk05218  Melanoma
elk05219  Bladder cancer
elk05220  Chronic myeloid leukemia
elk05223  Non-small cell lung cancer
elk05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:elk00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111159871
   04115 p53 signaling pathway
    111159871
   04218 Cellular senescence
    111159871
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111159871
   05206 MicroRNAs in cancer
    111159871
   05203 Viral carcinogenesis
    111159871
  09162 Cancer: specific types
   05212 Pancreatic cancer
    111159871
   05225 Hepatocellular carcinoma
    111159871
   05214 Glioma
    111159871
   05220 Chronic myeloid leukemia
    111159871
   05218 Melanoma
    111159871
   05219 Bladder cancer
    111159871
   05223 Non-small cell lung cancer
    111159871
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111159871
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111159871
   05163 Human cytomegalovirus infection
    111159871
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    111159871
   01522 Endocrine resistance
    111159871
SSDB
Motif
Pfam: Ank_5 Ank_4 Ank_2 Ank DUF2384 Arm-DNA-bind_3
Other DBs
NCBI-GeneID: 111159871
NCBI-ProteinID: XP_022378230
UniProt: A0A2Y9L9U6
LinkDB
Position
Unknown
AA seq 153 aa
MEPSADRLATAAARGRADEVRALLEAGVQPNALNRQGRSPIQVMMMGSTRVAELLLLHGA
NPNCADPITLTRPVHDAAREGFLDTLLVLHRAGAQLDVRDAWGRLPVDLAEERGHRAVAR
YLGAAAGATEGGSHSHTEVAESPAARTSRMIEI
NT seq 462 nt   +upstreamnt  +downstreamnt
atggagccctccgcagacagactagccacggccgcagcccggggccgggccgacgaggtg
cgggcgctgctcgaggccggggtgcagcccaacgcgctgaaccgccagggtcggagcccg
attcaggtcatgatgatgggcagcacccgcgtggcggagctgctgctgctccacggcgcc
aatcccaactgcgcggaccccatcactctcacccgacctgtgcacgacgcggcccgggag
ggcttcctggacacgctcctcgtgttgcaccgagccggggcgcagctggacgtgcgcgat
gcctggggccgcctgcccgtggacctggctgaggagcggggccaccgcgctgtcgcccgg
tacctgggcgcagccgcgggggccaccgaaggtggtagccactcccatacggaggttgcg
gaaagtcctgcagccaggacttcaagaatgattgagatctaa

DBGET integrated database retrieval system