KEGG   Enhydra lutris kenyoni (northern sea otter): 111159884
Entry
111159884         CDS       T05871                                 

Definition
(RefSeq) DNA repair protein RAD51 homolog 1
  KO
K04482  DNA repair protein RAD51
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk03440  Homologous recombination
elk03460  Fanconi anemia pathway
elk05200  Pathways in cancer
elk05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    111159884
   03460 Fanconi anemia pathway
    111159884
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111159884
  09162 Cancer: specific types
   05212 Pancreatic cancer
    111159884
Membrane trafficking [BR:elk04131]
 Protein recycling
  Rab GTPases and associated proteins
   Other Rab GTPase associated proteins
    111159884
Ubiquitin system [BR:elk04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   BRCC complex
    111159884
DNA repair and recombination proteins [BR:elk03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA complex
     111159884
    RecA family proteins
     111159884
   FA (Fanconi anemia) pathway
    Other FA pathway factors
     111159884
SSDB
Motif
Pfam: Rad51 AAA_25 RecA HHH_5 ATPase ssDNA_TraI_N HHH
Other DBs
NCBI-GeneID: 111159884
NCBI-ProteinID: XP_022378252
UniProt: A0A2Y9KW40
LinkDB
Position
Unknown
AA seq 339 aa
MAMQMQLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKEL
INIKGISEAKADKILTEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETG
SITEMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGL
SGSDVLDNVAYARGFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSA
RQMHLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRL
YLRKGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD
NT seq 1020 nt   +upstreamnt  +downstreamnt
atggctatgcaaatgcagcttgaagcaaatgcagatacttcagtggaagaagaaagcttt
ggcccacaacctatttcacggttagagcaatgtggtataaatgccaatgatgtgaagaaa
ttggaagaggctggattccatactgtggaggctgttgcctatgcaccaaagaaggaattg
ataaatattaaggggattagtgaagccaaagctgacaaaattctgactgaggcagctaaa
ttagttccaatgggtttcactactgcaactgagttccaccaaaggcggtcagagatcata
cagattactactggctcaaaagaacttgacaaactacttcaaggaggaattgaaaccgga
tccatcacagagatgtttggagaattccgaactgggaagactcaaatctgtcatacgttg
gctgtaacatgccagcttcccattgaccgaggtggaggagaaggaaaggccatgtacatt
gacactgagggtaccttcaggccagaacggctgctagcagtggctgagagatatggcctc
tctggcagtgatgtcctggataatgtagcatatgctcgagggttcaacacagaccaccag
acccagctcctttatcaagcatcggccatgatggtggaatctaggtatgcgctgctcatt
gtagacagtgccactgccctgtacagaacggactattcaggtcgaggggagctttcagcc
aggcagatgcacttggccaggtttctgcgaatgcttctgcgacttgctgatgagtttggt
gtggcagtggtaatcaccaaccaggtggtagcccaagtggatggagcagccatgtttgct
gcagatcctaaaaaacctattggaggaaatatcattgctcacgcttcaacaaccagactg
tatctgaggaaaggaagaggggaaaccagaatctgcaaaatctacgactctccctgtctt
cctgaagctgaagctatgtttgccatcaatgcagatggagtgggagatgccaaagactga

DBGET integrated database retrieval system