KEGG   Enhydra lutris kenyoni (northern sea otter): 111160135
Entry
111160135         CDS       T05871                                 

Definition
(RefSeq) cyclin-dependent kinase 2 isoform X1
  KO
K02206  cyclin-dependent kinase 2 [EC:2.7.11.22]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04068  FoxO signaling pathway
elk04110  Cell cycle
elk04114  Oocyte meiosis
elk04115  p53 signaling pathway
elk04151  PI3K-Akt signaling pathway
elk04218  Cellular senescence
elk04914  Progesterone-mediated oocyte maturation
elk04934  Cushing syndrome
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05162  Measles
elk05165  Human papillomavirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05169  Epstein-Barr virus infection
elk05200  Pathways in cancer
elk05203  Viral carcinogenesis
elk05215  Prostate cancer
elk05222  Small cell lung cancer
elk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    111160135
   04151 PI3K-Akt signaling pathway
    111160135
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111160135
   04114 Oocyte meiosis
    111160135
   04115 p53 signaling pathway
    111160135
   04218 Cellular senescence
    111160135
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    111160135
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111160135
   05203 Viral carcinogenesis
    111160135
  09162 Cancer: specific types
   05226 Gastric cancer
    111160135
   05215 Prostate cancer
    111160135
   05222 Small cell lung cancer
    111160135
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    111160135
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111160135
   05161 Hepatitis B
    111160135
   05160 Hepatitis C
    111160135
   05162 Measles
    111160135
   05169 Epstein-Barr virus infection
    111160135
   05165 Human papillomavirus infection
    111160135
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:elk01001]
    111160135
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:elk03032]
    111160135
   03036 Chromosome and associated proteins [BR:elk03036]
    111160135
Enzymes [BR:elk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     111160135
Protein kinases [BR:elk01001]
 Serine/threonine kinases: CMGC group
  CDK family
   111160135
DNA replication proteins [BR:elk03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    111160135
Chromosome and associated proteins [BR:elk03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    111160135
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Haspin_kinase Kinase-like
Other DBs
NCBI-GeneID: 111160135
NCBI-ProteinID: XP_022378687
UniProt: A0A2Y9KX99
LinkDB
Position
Unknown
AA seq 346 aa
MENFQKVEKIGEGTYGVVYKAKNKVTGEVVALKKIRLDTETEGVPSTAIREISLLKELNH
PNIVKLLDVIHTENKLYLVFEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHS
HRVLHRDLKPQNLLINAEGAIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKYY
STAVDIWSLGCIFAEMHLVCTQHQGRCCGEHRRNGRHSLCPLCSYLEVAASQGGGMTAVS
TPHPVTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVV
PPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL
NT seq 1041 nt   +upstreamnt  +downstreamnt
atggagaacttccaaaaagtggaaaagatcggagagggcacgtacggagttgtgtacaaa
gccaaaaacaaggtgacgggagaagtggtggcgcttaaaaaaatccgcctggacactgag
acggagggtgtacccagtactgctatacgagagatctctctgcttaaggagcttaaccac
cctaacattgtcaagctgctggatgtcatccacacggaaaacaaactctacctggttttt
gagtttctgcatcaggatctgaagaaatttatggatgcctctgctttgactggcattcct
cttcccctcatcaagagctatctgttccagctgctccagggcctagccttctgtcattct
catcgggttctgcaccgagacctcaaacctcagaatctgcttatcaatgcagagggggcc
atcaagctagcagactttggactagccagagcctttggagtccctgttcgtacttacacc
cacgaggtggtgaccctgtggtaccgagcacctgaaatccttctgggctgcaagtactac
tccacagctgtagatatctggagtctgggctgcatctttgctgagatgcacctagtgtgt
acccagcaccagggtaggtgctgtggggaacacagaagaaatggaagacacagtctctgc
ccgctgtgctcctatctagaagtggctgcatcacaaggaggggggatgaccgcagtgtct
accccacaccccgtgacccgccgggccttattccctggagattctgaaattgaccaactt
ttccggatctttcggactctggggaccccagatgaagtggtttggccaggagttacttct
atgcctgattataagccaagtttccccaagtgggcccggcaggattttagcaaagttgtt
cctcccttggatgaagatggacggagcttgctatcgcaaatgctgcactacgaccccaac
aagcggatttcggcaaaggcagctctggctcaccctttcttccaggatgtgaccaagcca
gtaccccaccttcgactctga

DBGET integrated database retrieval system