KEGG   Enhydra lutris kenyoni (northern sea otter): 111160341
Entry
111160341         CDS       T05871                                 

Definition
(RefSeq) baculoviral IAP repeat-containing protein 5
  KO
K08731  baculoviral IAP repeat-containing protein 5
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01524  Platinum drug resistance
elk04210  Apoptosis
elk04215  Apoptosis - multiple species
elk04390  Hippo signaling pathway
elk05161  Hepatitis B
elk05200  Pathways in cancer
elk05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    111160341
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111160341
   04215 Apoptosis - multiple species
    111160341
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111160341
  09162 Cancer: specific types
   05210 Colorectal cancer
    111160341
  09172 Infectious disease: viral
   05161 Hepatitis B
    111160341
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    111160341
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:elk01002]
    111160341
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:elk03036]
    111160341
Peptidases and inhibitors [BR:elk01002]
 Peptidase inhibitors
  Family I32: IAP family
   111160341
Chromosome and associated proteins [BR:elk03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CPC (chromosomal passenger complex)
     111160341
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    111160341
SSDB
Motif
Pfam: BIR
Other DBs
NCBI-GeneID: 111160341
NCBI-ProteinID: XP_022379093
UniProt: A0A2Y9L157
LinkDB
Position
Unknown
AA seq 142 aa
MGASSLPPAWQLYLKDHRVSTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFC
FKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLSEFLKLDKERAKNKIAKETNSK
QREFEETAKRVRCAIEQLAATE
NT seq 429 nt   +upstreamnt  +downstreamnt
atgggcgcttcgtcgttgccccccgcctggcagctctacctcaaggaccaccgcgtctct
acgttcaagaactggccgttcctggagggctgcgcctgcaccccggagcggatggccgag
gccggcttcatccactgtcccactgagaacgagcccgacttggcccagtgcttcttctgc
ttcaaggagctggaaggctgggagccggatgatgaccctatagaggagcataagaagcat
tcatctggttgtgctttcctttctgtcaagaagcagtttgaagaattaaccctcagtgaa
tttttgaaactggacaaagagagagccaagaacaaaatcgcaaaggaaaccaacagtaag
cagagagaattcgaagagacggcaaagagagtgcgctgtgccatcgagcagctggccgcc
acggagtga

DBGET integrated database retrieval system