KEGG   Enhydra lutris kenyoni (northern sea otter): 111160657
Entry
111160657         CDS       T05871                                 

Definition
(RefSeq) apoptosis regulator BAX isoform X1
  KO
K02159  apoptosis regulator BAX
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01521  EGFR tyrosine kinase inhibitor resistance
elk01522  Endocrine resistance
elk01524  Platinum drug resistance
elk04071  Sphingolipid signaling pathway
elk04115  p53 signaling pathway
elk04141  Protein processing in endoplasmic reticulum
elk04210  Apoptosis
elk04211  Longevity regulating pathway
elk04215  Apoptosis - multiple species
elk04217  Necroptosis
elk04722  Neurotrophin signaling pathway
elk04932  Non-alcoholic fatty liver disease
elk04933  AGE-RAGE signaling pathway in diabetic complications
elk05012  Parkinson disease
elk05014  Amyotrophic lateral sclerosis
elk05016  Huntington disease
elk05020  Prion disease
elk05022  Pathways of neurodegeneration - multiple diseases
elk05132  Salmonella infection
elk05152  Tuberculosis
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05162  Measles
elk05163  Human cytomegalovirus infection
elk05164  Influenza A
elk05165  Human papillomavirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
elk05200  Pathways in cancer
elk05202  Transcriptional misregulation in cancer
elk05203  Viral carcinogenesis
elk05210  Colorectal cancer
elk05212  Pancreatic cancer
elk05213  Endometrial cancer
elk05214  Glioma
elk05216  Thyroid cancer
elk05217  Basal cell carcinoma
elk05218  Melanoma
elk05220  Chronic myeloid leukemia
elk05222  Small cell lung cancer
elk05223  Non-small cell lung cancer
elk05224  Breast cancer
elk05225  Hepatocellular carcinoma
elk05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    111160657
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    111160657
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111160657
   04215 Apoptosis - multiple species
    111160657
   04217 Necroptosis
    111160657
   04115 p53 signaling pathway
    111160657
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    111160657
  09149 Aging
   04211 Longevity regulating pathway
    111160657
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111160657
   05202 Transcriptional misregulation in cancer
    111160657
   05203 Viral carcinogenesis
    111160657
  09162 Cancer: specific types
   05210 Colorectal cancer
    111160657
   05212 Pancreatic cancer
    111160657
   05225 Hepatocellular carcinoma
    111160657
   05226 Gastric cancer
    111160657
   05214 Glioma
    111160657
   05216 Thyroid cancer
    111160657
   05220 Chronic myeloid leukemia
    111160657
   05217 Basal cell carcinoma
    111160657
   05218 Melanoma
    111160657
   05213 Endometrial cancer
    111160657
   05224 Breast cancer
    111160657
   05222 Small cell lung cancer
    111160657
   05223 Non-small cell lung cancer
    111160657
  09164 Neurodegenerative disease
   05012 Parkinson disease
    111160657
   05014 Amyotrophic lateral sclerosis
    111160657
   05016 Huntington disease
    111160657
   05020 Prion disease
    111160657
   05022 Pathways of neurodegeneration - multiple diseases
    111160657
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    111160657
   04933 AGE-RAGE signaling pathway in diabetic complications
    111160657
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111160657
   05152 Tuberculosis
    111160657
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111160657
   05170 Human immunodeficiency virus 1 infection
    111160657
   05161 Hepatitis B
    111160657
   05160 Hepatitis C
    111160657
   05164 Influenza A
    111160657
   05162 Measles
    111160657
   05168 Herpes simplex virus 1 infection
    111160657
   05163 Human cytomegalovirus infection
    111160657
   05167 Kaposi sarcoma-associated herpesvirus infection
    111160657
   05169 Epstein-Barr virus infection
    111160657
   05165 Human papillomavirus infection
    111160657
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111160657
   01524 Platinum drug resistance
    111160657
   01522 Endocrine resistance
    111160657
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:elk03029]
    111160657
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:elk02000]
    111160657
Mitochondrial biogenesis [BR:elk03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    111160657
Transporters [BR:elk02000]
 Other transporters
  Pores ion channels [TC:1]
   111160657
SSDB
Motif
Pfam: Bcl-2 SCNM1_acidic CF222
Other DBs
NCBI-GeneID: 111160657
NCBI-ProteinID: XP_022379606
UniProt: A0A2Y9L107
LinkDB
Position
Unknown
AA seq 206 aa
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGETPELALEQAPQDASTKKLS
ECLKRIGDELDSNVELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKL
VLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWVRPPNPLPHSSGLRSPLVLLSL
TLGHQTGSVMPFLTGLINSSNLSGIH
NT seq 621 nt   +upstreamnt  +downstreamnt
atggacgggtccggggagcaacccagaggcggggggcccaccagctctgagcagatcatg
aagacaggggcccttttgcttcagggtttcatccaagatcgagcagggcgaatgggggga
gagacaccagagctggccctcgagcaggcgccccaggatgcatccaccaagaagctgagc
gagtgtctcaagcgcatcggagatgaactggacagtaacgtggagttacagaggatgatt
gcagccgtggacacagactccccccgcgaggtctttttccgagtggcagctgacatgttt
tctgatggcaacttcaactggggtcgggtcgttgccctcttctactttgccagcaaactg
gtgctcaaggccctgtgtaccaaggtgcccgagctgatcaggaccatcatgggctggaca
ctggacttccttcgagagcgactgctgggctggatccaggaccagggtggttgggtgagg
ccccctaaccccctcccccactcctcgggtcttcgaagcccactagtgttgctctctctg
actctgggtcatcaaacggggtctgtaatgcctttcctcacaggtctgatcaactcctct
aatttgtccggtatccactga

DBGET integrated database retrieval system