KEGG   Enhydra lutris kenyoni (northern sea otter): 111160670
Entry
111160670         CDS       T05871                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: bcl-2-binding component 3
  KO
K10132  Bcl-2-binding component 3
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01524  Platinum drug resistance
elk04115  p53 signaling pathway
elk04210  Apoptosis
elk04215  Apoptosis - multiple species
elk04390  Hippo signaling pathway
elk05016  Huntington disease
elk05162  Measles
elk05200  Pathways in cancer
elk05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    111160670
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111160670
   04215 Apoptosis - multiple species
    111160670
   04115 p53 signaling pathway
    111160670
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111160670
  09162 Cancer: specific types
   05210 Colorectal cancer
    111160670
  09164 Neurodegenerative disease
   05016 Huntington disease
    111160670
  09172 Infectious disease: viral
   05162 Measles
    111160670
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    111160670
SSDB
Motif
Pfam: PUMA Hepatitis_core Ciart
Other DBs
NCBI-GeneID: 111160670
NCBI-ProteinID: XP_022379644
UniProt: A0A2Y9L7P1
LinkDB
Position
Unknown
AA seq 193 aa
MARARQEGSSPEPVEGLSRDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAAPALLPAAYLC
APTAPPAVTAALGGPRWPGGPRSRPRGPRPDGPQPSLSPAEPHLESPVPSAPGALAGGPT
QAAPGVRGEEEQWAREIGAQLRRMADDLNALYERRRQEEQQRHRPSPWRVLYNLIMGLLP
LPRGRGAPEMEPN
NT seq 582 nt   +upstreamnt  +downstreamnt
atggcccgagcacgccaggagggcagctccccggagcccgtagagggcctgtcccgcgac
ggcccgcgcccctttcccctcagccgcctggtgccctcggccgtgtcctgtggcctctgc
gagcccggcctgcccgccgcccccgccgctcccgccctgctgcccgccgcctacctctgc
gcccccaccgcccctcccgccgtcaccgccgccctggggggcccccgctggcctgggggt
ccccgcagccggccccgaggcccgcgccccgacggtcctcagccctcactctcgccggcg
gagccgcacctggaatcgccggtgcccagtgccccgggggccctggcgggcggccccacc
caggcagccccgggagtccggggggaggaggagcagtgggcccgggagatcggggcccag
ctgcggaggatggcggacgacctcaacgcgctgtacgagcggcggagacaagaggagcag
cagcgacaccgcccctccccctggagggtcctgtacaatctcatcatgggactcctgccc
ttacccaggggccgtggagccccagagatggagcccaattag

DBGET integrated database retrieval system