KEGG   Enhydra lutris kenyoni (northern sea otter): 111161016
Entry
111161016         CDS       T05871                                 

Definition
(RefSeq) androgen receptor
  KO
K08557  androgen receptor
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04114  Oocyte meiosis
elk05200  Pathways in cancer
elk05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    111161016
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111161016
  09162 Cancer: specific types
   05215 Prostate cancer
    111161016
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:elk03000]
    111161016
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:elk03310]
    111161016
Transcription factors [BR:elk03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    111161016
Nuclear receptors [BR:elk03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   111161016
SSDB
Motif
Pfam: Androgen_recep Hormone_recep zf-C4 TFIIA
Other DBs
NCBI-GeneID: 111161016
NCBI-ProteinID: XP_022380163
UniProt: A0A2Y9L470
LinkDB
Position
Unknown
AA seq 891 aa
MEVQLGLGRVYPRPPSKTYRGAFQNLFQSVREVIQNPGPRHPEAASAAPPGARLQQQQQQ
QQETSSGQQQQQQQQQGDDGSPQAQRRGPTGYLALDEEQQPSQQQSAPKGHPESGCVPEP
GAASATGKGLQQQQPAPPDEDDSAAPSTLSLLGPTFPGLSSCSTDLKDILSEAGTMQLLQ
QQQEVVSEGSSSGRAREAAGAPTSSKDSYLGGSSTISDSAKELCKAVSVSMGLGVETLEH
LSPGEQLRGDCMYAPILGGPPAVRPCAPLAECKGSLLDDGASKGTEETAEYSPFKAGYAK
GLDGDSLGCSGTSEAGGSGTLELPSTLSLYKSGALDEAAAYQNRDYYNFPLALAGPPPPP
LPPLPPHPHARIKLENPLDYGSAWAAAAAQCRYGDLSSLHGGGAAGPSSGSPSATASSSW
HTLFTAEEGQLYGPCGGSGGGSAGEAGSVAPYGYTRPPQGLAGQEGDFPPPDVWYPGGVV
NRVPYPSPSCVKSEMGPWMESYSGPYGDMRLETARDHVLPIDYYFPPQKTCLICGDEASG
CHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLGA
RKLKKLGNLKLQEEGETSSATSPTEEPTQKLTVSHIEGYECQPIFLNVLEAIEPGVVCAG
HDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFA
MGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMK
ALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQP
IARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHTQ
NT seq 2676 nt   +upstreamnt  +downstreamnt
atggaggttcagttagggctagggagggtctatccccggccgccatccaagacctatcga
ggagctttccagaacctgttccagagcgtgcgcgaagtgatccagaacccgggcccacgg
caccctgaggccgcgagcgcagcacctcccggcgcccgtttgcagcagcagcagcagcag
cagcaggagaccagttctgggcagcagcagcagcaacaacagcagcagggtgacgatggc
tctccccaagcccagagaagaggccccacaggttacctggccctggacgaggaacagcag
ccttcccaacaacagtcagcccccaagggccatccggagagcggctgcgttccagagcct
ggagctgcttcagccaccggcaaggggctgcaacagcagcagccagcaccaccggacgag
gatgactcagctgccccatccacgttgtccctgctgggccccactttcccgggcttaagt
agctgttccaccgatcttaaagacatcctgagcgaggccggcaccatgcaactcctgcag
cagcagcaggaggtagtatccgaaggtagcagcagcgggagagcgagggaggccgctggt
gctcccacctcctccaaggacagttacctagggggcagttcgaccatctcggacagcgcc
aaggagttgtgtaaggcagtgtcggtgtccatgggcttgggtgtggagacattagagcat
ctgagtcctggggaacagcttcggggggattgcatgtatgccccaatcctgggaggtccg
cccgcggtacgtccctgcgccccgctggccgaatgcaaaggttctctgctggatgacggc
gcaagcaagggcacggaagaaactgctgagtattctcctttcaaggcaggttatgccaaa
gggttggatggcgacagcctgggttgttcgggcacgagcgaagccgggggctccggaaca
cttgagctgccatccaccctttctctctacaagtcgggagcactagatgaagcggcggct
tatcagaatcgcgactactacaactttccgctcgcgctagccgggcctccgccccctccg
ctccctccgctccctccccatcctcacgcccgcatcaagctggaaaacccgctggactac
ggtagcgcctgggcggctgctgcggcacaatgccgttacggagatctgtcgagcctgcat
ggtgggggtgcagcgggacccagctcaggatcaccctccgccaccgcctcctcttcctgg
cacactctcttcacagccgaagaaggccagctgtatgggccctgcggcgggagcggaggc
ggcagcgctggcgaggcagggtctgtagccccctatggctacactcggccacctcagggg
ttggcaggccaggaaggtgacttcccgccacctgatgtgtggtatcccggcggtgtggtg
aacagagttccctatccaagtcccagctgtgtcaaaagcgagatgggcccctggatggag
agttactctggaccctatggggacatgcgtttggagactgccagagatcatgttctaccc
attgactattacttcccaccccagaagacctgcctgatttgtggcgatgaagcttctggc
tgtcactatggagctctcacttgtggaagctgcaaagtcttctttaaaagggctgctgaa
ggtaaacagaagtacctgtgtgccagcagaaacgattgcaccattgataaattccgaagg
aaaaattgcccatcttgtcgcctccggaaatgctatgaagcagggatgactctgggagcc
cggaagctgaagaaacttggtaatctgaaactacaagaggaaggggagacttccagtgcc
accagtcccactgaggagccaacccagaagttgacagtgtcacatattgaaggctatgag
tgtcagcccatctttctgaatgtccttgaagccattgagccgggcgtggtgtgtgctgga
catgacaacaaccagcctgactccttcgcagccttgctttctagccttaatgaattgggt
gaaagacagcttgtacatgtggtcaagtgggccaaggccttgcctggcttccgcaacttg
catgtggatgaccagatggcagtcattcagtactcctggatggggcttatggtgtttgcc
atgggctggcggtccttcaccaatgtcaactccaggatgctctacttcgcccctgacctg
gtcttcaatgaataccgtatgcacaagtcccggatgtacagccagtgtgtccgaatgagg
cacctctctcaagaatttggatggctccagatcaccccccaggaatttttgtgcatgaag
gcactgctgctgttcagcattattccagtggatgggctgaaaaatcaaaaattctttgat
gaacttcgaatgaactacatcaaggaacttgatcgtatcattgcttgcaagagaaaaaat
cccacatcctgctcaaggcgcttctaccagctcaccaagctcctggactctgtgcaacct
attgcacgagagctgcatcagttcacttttgacctgctaatcaagtcccacatggtgagc
gtggactttccagaaatgatggcagaaatcatctctgtgcaagtgcccaagattctttct
gggaaagtcaagcccatctatttccacacacagtga

DBGET integrated database retrieval system