KEGG   Enhydra lutris kenyoni (northern sea otter): 111161133
Entry
111161133         CDS       T05871                                 

Definition
(RefSeq) cellular tumor antigen p53
  KO
K04451  tumor protein p53
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk01522  Endocrine resistance
elk01524  Platinum drug resistance
elk04010  MAPK signaling pathway
elk04071  Sphingolipid signaling pathway
elk04110  Cell cycle
elk04115  p53 signaling pathway
elk04137  Mitophagy - animal
elk04151  PI3K-Akt signaling pathway
elk04210  Apoptosis
elk04211  Longevity regulating pathway
elk04216  Ferroptosis
elk04218  Cellular senescence
elk04310  Wnt signaling pathway
elk04722  Neurotrophin signaling pathway
elk04919  Thyroid hormone signaling pathway
elk05012  Parkinson disease
elk05014  Amyotrophic lateral sclerosis
elk05016  Huntington disease
elk05160  Hepatitis C
elk05161  Hepatitis B
elk05162  Measles
elk05163  Human cytomegalovirus infection
elk05165  Human papillomavirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05200  Pathways in cancer
elk05202  Transcriptional misregulation in cancer
elk05203  Viral carcinogenesis
elk05205  Proteoglycans in cancer
elk05206  MicroRNAs in cancer
elk05210  Colorectal cancer
elk05212  Pancreatic cancer
elk05213  Endometrial cancer
elk05214  Glioma
elk05215  Prostate cancer
elk05216  Thyroid cancer
elk05217  Basal cell carcinoma
elk05218  Melanoma
elk05219  Bladder cancer
elk05220  Chronic myeloid leukemia
elk05222  Small cell lung cancer
elk05223  Non-small cell lung cancer
elk05224  Breast cancer
elk05225  Hepatocellular carcinoma
elk05226  Gastric cancer
elk05230  Central carbon metabolism in cancer
elk05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111161133
   04310 Wnt signaling pathway
    111161133
   04071 Sphingolipid signaling pathway
    111161133
   04151 PI3K-Akt signaling pathway
    111161133
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    111161133
  09143 Cell growth and death
   04110 Cell cycle
    111161133
   04210 Apoptosis
    111161133
   04216 Ferroptosis
    111161133
   04115 p53 signaling pathway
    111161133
   04218 Cellular senescence
    111161133
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    111161133
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    111161133
  09149 Aging
   04211 Longevity regulating pathway
    111161133
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111161133
   05202 Transcriptional misregulation in cancer
    111161133
   05206 MicroRNAs in cancer
    111161133
   05205 Proteoglycans in cancer
    111161133
   05203 Viral carcinogenesis
    111161133
   05230 Central carbon metabolism in cancer
    111161133
  09162 Cancer: specific types
   05210 Colorectal cancer
    111161133
   05212 Pancreatic cancer
    111161133
   05225 Hepatocellular carcinoma
    111161133
   05226 Gastric cancer
    111161133
   05214 Glioma
    111161133
   05216 Thyroid cancer
    111161133
   05220 Chronic myeloid leukemia
    111161133
   05217 Basal cell carcinoma
    111161133
   05218 Melanoma
    111161133
   05219 Bladder cancer
    111161133
   05215 Prostate cancer
    111161133
   05213 Endometrial cancer
    111161133
   05224 Breast cancer
    111161133
   05222 Small cell lung cancer
    111161133
   05223 Non-small cell lung cancer
    111161133
  09164 Neurodegenerative disease
   05012 Parkinson disease
    111161133
   05014 Amyotrophic lateral sclerosis
    111161133
   05016 Huntington disease
    111161133
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111161133
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111161133
   05161 Hepatitis B
    111161133
   05160 Hepatitis C
    111161133
   05162 Measles
    111161133
   05168 Herpes simplex virus 1 infection
    111161133
   05163 Human cytomegalovirus infection
    111161133
   05167 Kaposi sarcoma-associated herpesvirus infection
    111161133
   05169 Epstein-Barr virus infection
    111161133
   05165 Human papillomavirus infection
    111161133
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    111161133
   01522 Endocrine resistance
    111161133
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:elk03000]
    111161133
   03036 Chromosome and associated proteins [BR:elk03036]
    111161133
   03400 DNA repair and recombination proteins [BR:elk03400]
    111161133
Transcription factors [BR:elk03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    111161133
Chromosome and associated proteins [BR:elk03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     111161133
DNA repair and recombination proteins [BR:elk03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    111161133
SSDB
Motif
Pfam: P53 P53_tetramer P53_TAD
Other DBs
NCBI-GeneID: 111161133
NCBI-ProteinID: XP_022380348
UniProt: A0A2Y9L4Q2
LinkDB
Position
Unknown
AA seq 379 aa
MQDPQSELTIDPPLSQETFSELWNLLPENNVLSSELSPAVDELLSEGVNWLGEGSNDAPR
MPATPAPAAPGPAPSWPLSSFVPSPKTYPGAYGFRLGFLHSGTAKSVTCTYSPSLNKLFC
QLAKTCPVQLWVSSPPPADTCVRAMAIYKKSEFVTEVVRRCPHHERCLDSSDGLAPPQHL
IRVEGNLRAKYLDDRNTFRQSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTI
ITLEDSSGNVLGRSSFEVRVCACPGRDRRTEEENFRKKGEPCPEPPPGSTKRALPPSTSS
SPPQKKKPLDGEYFTLQIRGLERYNMFRELNEALELKDALNGKEPGGSRAHSSHLKAKKG
QSTSRHKKPMLKKEGPDSD
NT seq 1140 nt   +upstreamnt  +downstreamnt
atgcaggacccacagtccgagctcaccatcgacccccctctaagccaggagacattttcc
gaattgtggaacctgcttcctgaaaacaatgttctgtcttccgagctgtcccccgcagtg
gatgaactgctgtcagaaggcgtgaactggctgggagaagggtccaatgacgctcccagg
atgccggcgactcctgcgcccgcggcccccggacccgccccctcctggcccctgtcatcc
tttgtcccttccccgaagacctaccctggcgcctatgggttccgtctggggttcctgcat
tccgggacagccaagtctgttacttgcacgtactccccctccctcaacaagctgttctgt
cagctggcaaagacctgccccgtgcagctgtgggtcagctcgccacccccagccgacacc
tgtgtccgggccatggccatttacaagaagtcggagtttgtgacggaggtggtgcggcgc
tgcccccaccacgagcgctgcttggacagtagtgatggtctggccccgcctcagcatctc
atccgggtggagggaaacctgcgggccaagtacctggacgacaggaacaccttccggcag
agcgtggtggtgccctacgagccacccgaggtgggctccgactgcaccaccatccactat
aactacatgtgtaacagttcctgcatggggggcatgaaccgccggcccatcctcaccatc
atcactctggaagattccagtggtaacgtgctgggacggagcagcttcgaggtacgagtc
tgtgcctgtcccgggagagaccggcgcacagaggaggaaaatttccgcaagaagggggag
ccttgccccgagccgccccccgggagcaccaagcgagcactgcctcccagcaccagctca
tctcccccgcaaaagaagaagccactggatggggagtacttcacccttcagatccgtggc
cttgaacgctacaacatgttcagggagttgaatgaggccttggagctgaaggatgccctg
aacggaaaggagccagggggaagcagggctcactccagccacctgaaggctaagaagggg
cagtccacctcccgccataaaaaaccgatgctcaagaaagaggggcccgattcagactga

DBGET integrated database retrieval system