KEGG   Enhydra lutris kenyoni (northern sea otter): 111161450
Entry
111161450         CDS       T05871                                 

Definition
(RefSeq) kunitz-type protease inhibitor 1 isoform X1
  KO
K15619  Kunitz-type protease inhibitor 1
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk05202  Transcriptional misregulation in cancer
elk05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    111161450
  09162 Cancer: specific types
   05215 Prostate cancer
    111161450
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:elk01002]
    111161450
Peptidases and inhibitors [BR:elk01002]
 Peptidase inhibitors
  Family I2: Kunitz - BPTI family
   111161450
SSDB
Motif
Pfam: Kunitz_BPTI MANEC Ldl_recept_a
Other DBs
NCBI-GeneID: 111161450
NCBI-ProteinID: XP_022380820
UniProt: A0A2Y9LGQ9
LinkDB
Position
Unknown
AA seq 537 aa
MATAQGRMMACARLSQARVPAVVVWLLCALDLLGTEAGPPPAPPGLPTGAPCLERFTAGV
PAFVLDTEASVSNGATFLGSPTVRRGWDCVRACCTTQNCNLALVELQPDGGEDAIAACFL
MNCLYEQNFVCKFAPREGFINYLTREVYQSYRELRTQGFGAPRIPKVRAGIDLKVQPQEP
LVLKDMENTDWYLLQGDTDVRVEKNEPDQVKLWGLKEGTYVFQLTAAHSNQPESMTNITV
TVLSPKQTEEYCLASSKVGRCRGSFPRWYYDPKEQICKSFVYGGCLGNKNNYLREEECKL
ACRDVQGGPLWGSFGAQVTFPMGPSLERHGPVCSGTCHPAEFRCRNGCCIDSFLECDDTP
DCPDASDEATCEKYTNGFEELQNIHFRSDKGHCVDLPDTGLCQENIPRWYYNPFSERCAR
FTYGGCYGNKNNFEEEQQCLASCRGVSKKDVFGLRRESPIPNIGSVEVAIAVLLVTCIVV
VTALLGYCFFKDQRKGLHRYGHRRQHYHPQPPTPANSTVSTTEDTEHLVYNHTTQPL
NT seq 1614 nt   +upstreamnt  +downstreamnt
atggcgacggcccaggggaggatgatggcctgcgcccgcctctcccaggcccgcgtccca
gcagtcgtcgtgtggctcctgtgcgcgctcgacctcctgggcaccgaggcagggccgccg
cccgcgccccccgggctgcccacgggagccccctgtctggagcgctttaccgccggggtg
cctgccttcgtgctcgataccgaggcctcggtcagcaacggggccaccttcctgggctcc
cccaccgtgcgccgcggctgggactgcgtgcgcgcctgctgcaccacccagaactgcaac
ctggcgctggtggagctgcagcccgacggcggggaggacgccattgcagcctgcttccta
atgaactgcctctacgagcagaacttcgtgtgcaagttcgcgcccagggagggcttcatc
aactacctcacgcgggaagtttaccagtcctaccgcgagctgcggacccagggttttggc
gcgccccggatccccaaggtccgggcaggcatagacttgaaggtgcagccccaggaaccc
ttggtgctgaaggacatggagaacacagattggtacctactacagggtgacacggatgtc
agagtagagaagaatgagccggaccaggtgaagctgtggggactcaaggaaggcacctac
gtgttccagctgacagcggcccattccaaccagccagagagcatgaccaatatcacagtt
actgtgctatcccccaagcagacagaagaatattgcctcgcatccagcaaggtgggccgc
tgccgcggttccttcccgcgctggtactacgaccccaaagaacagatttgcaagagtttc
gtttacggaggttgcttgggcaataagaacaactatcttcgggaagaggagtgcaagcta
gcctgcagggatgtgcaaggtgggcctttatggggtagctttggggctcaggtgactttc
cccatgggcccctcactggaaaggcacggtccggtgtgctctggcacctgtcaccctgcc
gagttccgctgccgcaacggctgttgcattgacagcttcctggagtgtgacgacactccc
gactgccccgatgcctccgacgaggccacctgtgagaaatacaccaatggctttgaggag
ctccagaacatccacttccgcagtgacaaagggcactgtgtggacctgccagacacaggc
ctctgccaggagaacattccacgctggtactacaaccccttcagtgaacgctgtgcccgc
tttacctatggtggctgttatggcaacaagaacaactttgaggaggagcagcagtgtctt
gcgtcctgtcgcggtgtctccaagaaggatgtttttgggctccggcgggaaagccccatt
cctaacataggctccgtggaggtggccattgcagtcctcctggtcacctgcatcgtggtg
gtgacagccctgttgggttactgcttcttcaaggaccagaggaagggcctccacagatac
ggccaccgccgccaacactaccaccctcagccccctacccctgccaactctacggtctcc
accacagaggacacagagcacctggtctataaccacaccacccagcccctctga

DBGET integrated database retrieval system