KEGG   Enhydra lutris kenyoni (northern sea otter): 111161492
Entry
111161492         CDS       T05871                                 

Definition
(RefSeq) mRNA decay activator protein ZFP36
  KO
K15308  tristetraprolin
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk05166  Human T-cell leukemia virus 1 infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:elk00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111161492
   05167 Kaposi sarcoma-associated herpesvirus infection
    111161492
Messenger RNA biogenesis [BR:elk03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     111161492
SSDB
Motif
Pfam: zf-CCCH zf_CCCH_4 zf-CCCH_4 zf-CCCH_2 Torus
Other DBs
NCBI-GeneID: 111161492
NCBI-ProteinID: XP_022380896
UniProt: A0A2Y9L4R1
LinkDB
Position
Unknown
AA seq 327 aa
MDLSAIYESLVSMSPDLLSDHGETESSPSWASSGLWSLSSSDNNPAGVGARLPGRSTSLV
EGRSCGWVPPPPGFAPLAPRPGPELTPSPTSPTATPTTSSRYKTELCRTFSESGRCRYGA
KCQFAHGLGELRQASRHPKYKTELCHKFYLQGRCPYGSRCHFIHNLNEDLAAPGHPPVLR
QSISFSGLPSGRRTSPPPAGLAGPSLSSCSFSPSSSPPPPPGDLPLSPSAFSAAPGTPVA
RRDPTPACCPSCRRATTSSVWGPLGGLARSPSAHSLGSDPDEYASSGSSLGGSDSPVFEA
GVFGPPQPPAAAAPRRLPIFNRISVSE
NT seq 984 nt   +upstreamnt  +downstreamnt
atggatctctccgccatctacgagagcctcgtgtcgatgagccctgacctgctatctgac
cacggagagaccgagtccagcccaagctgggcctcctcgggactctggagcctcagctca
tccgacaacaacccggctggggtgggtgcccgcctgcctggccgctccaccagcctggtg
gagggtcgaagctgtggctgggtgccaccacccccgggtttcgcccccctggctccccgc
ccgggccctgaactgacgccctcacccacctcacctactgcaacccccaccacctcatcc
cggtacaagactgagctctgtcggaccttctcggagagcgggcgctgccgctatggggcc
aagtgccagtttgcccatggtctgggggagctgcgtcaggccagccgccaccccaagtac
aagaccgaactctgccacaagttctacctccagggccgctgcccctacggctcccgctgc
cacttcatccacaacctcaatgaagatctggctgccccgggccacccccctgtgctgcgc
caaagcatcagcttctcaggcctgccctccggccgccggacatcaccgccaccggcaggc
ctggcaggcccttccctgtcctcctgctccttctctccctccagctccccaccaccacca
cctggggaccttccactttcaccctctgccttctctgctgcccctgggaccccagtggcc
cgaagggaccccaccccagcctgttgcccctcctgtcgaagggctaccactagtagcgtc
tggggacccttgggtggcctggctcggagcccctctgcacactccctgggatctgatcct
gatgaatatgccagcagtggcagcagcctggggggatccgactcacctgtcttcgaggct
ggggtttttgggcccccccagccgcctgcagctgcagccccccggcgacttcccatcttc
aaccgtatttcggtgtctgagtga

DBGET integrated database retrieval system