KEGG   Enhydra lutris kenyoni (northern sea otter): 111161841
Entry
111161841         CDS       T05871                                 

Definition
(RefSeq) complement C3
  KO
K03990  complement component 3
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04080  Neuroactive ligand-receptor interaction
elk04145  Phagosome
elk04610  Complement and coagulation cascades
elk04613  Neutrophil extracellular trap formation
elk05133  Pertussis
elk05134  Legionellosis
elk05140  Leishmaniasis
elk05142  Chagas disease
elk05150  Staphylococcus aureus infection
elk05152  Tuberculosis
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05168  Herpes simplex virus 1 infection
elk05171  Coronavirus disease - COVID-19
elk05203  Viral carcinogenesis
elk05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111161841
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    111161841
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    111161841
   04613 Neutrophil extracellular trap formation
    111161841
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111161841
  09163 Immune disease
   05322 Systemic lupus erythematosus
    111161841
  09171 Infectious disease: bacterial
   05133 Pertussis
    111161841
   05134 Legionellosis
    111161841
   05150 Staphylococcus aureus infection
    111161841
   05152 Tuberculosis
    111161841
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    111161841
   05168 Herpes simplex virus 1 infection
    111161841
   05167 Kaposi sarcoma-associated herpesvirus infection
    111161841
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    111161841
   05142 Chagas disease
    111161841
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:elk01002]
    111161841
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:elk04131]
    111161841
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:elk04147]
    111161841
Peptidases and inhibitors [BR:elk01002]
 Peptidase inhibitors
  Family I39: alpha2M family
   111161841
Membrane trafficking [BR:elk04131]
 Endocytosis
  Phagocytosis
   Opsonins
    111161841
Exosome [BR:elk04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   111161841
SSDB
Motif
Pfam: TED_complement A2M A2M_recep MG1 MG4 NTR A2M_BRD MG2 MG3 ANATO
Other DBs
NCBI-GeneID: 111161841
NCBI-ProteinID: XP_022381556
UniProt: A0A2Y9L6F4
LinkDB
Position
Unknown
AA seq 1660 aa
MGPALGPSLLLLLTSFPLVLGDPLFSVITPNILRLGSDETVVLEAHDWKENIGVTVTVHD
FPAKKQVLSNERTQLSSANDYLSTVTIRIPNDKDLISERGKSFVTVQAAFGATVVEKVVL
VSPQSGYLFIQTDKTIYTPGSTVHYRIFTVDNNLLPVGRSVIIVIQTPDGVPIKRDVLSS
VNQAGILSQSWNIPELVNMGQWKIQVHYEDAPQQVFSAEFEVKEYVLPSFEVHLEPEEKF
YYIDDPKGVTVTITARFLYGKNVDGVAFVIFGVQDGDHRISLAQSLRRIKIDDGTGEAML
SRNVLLNGVEPSRQDALVGMSLYVSVTVVLDSGSDMVEAEYSGIPIVTSPYQIHFTKTPK
FFKPAMPFDLMVFVTNPDGSPAHSVPVEIMGTEARTSTRNDGVAMLTMNTPKNIQPLIIT
VRTKKDGIPEPRQATREMKVQPYNAMGNFKNYLHLSVPRLELKAGETLTVNFHLRVDPSQ
EQSITYYTYLIMNKGKILTVGRQKRQPGQDLVVMPLITTQQFIPSFRLVAYYTVTGSNGK
REVVADSVWVDVKDSCVGTLVVKGVKKGERPYQPGHQMMLKIEGDPGARVGLVAVDKGVF
VLNKKNKLTQSKIWNVVENADIGCTAGSGQDYAGVFTDAGLALKTNKELQTAQRTNLECP
KPATRRRRSVQLMEKRLDKAGQYPKDVRMCCTQGMRDNIMKYPCERRAQFIAHEEQERCV
KAFLDCCHYIAQLRLNYSHDEPLGLARSDMNEEIFLEEIISRSQFPESWLWTVESLNEPE
KNGISTKTLNVFLKDSITTWEILAVSLSKNKGICVADPYEVVVMQDFFIDLRLPYSVVRN
EQVEIRAVLYNYQETEKLKVRVELLYNPAFCSLATAKKRYLQTVEIPPKSSVAVPYVIVP
LKLGLHEVEVKAAVYNYLISDGVKKTLKVVPEGVRVNQTVAVHTLNPEEKGEGGEQKVHI
RAADLSDQVPDTDLETRIVLQGTPVAQMTEDAIDGDRLKHLIVTPSGCGEQNMIGMTPTV
IAVHYLDQTEQWEKFSLEKRQDALEIIKKGYTQQLAFRQGNLAFAAFKDRAPSTWLTAYV
VKVFSLATNLIAIDSQVLCGAVKWLIMEKQKPDGIFHEDGPVIHQEMIGGSRDSKEKEVS
LTAFVLIALKEAEDICEGQVNSLPGSINKAGQYLEAHYENLQRSYSVAIAGYALAQIGKL
EGNLLRKFLRTAKDKERWEEPNQKLYSVEATSYALLALLLLKDFDSVPPVVRWLNEQRYY
GGGYGSTQATFMVFQALAQYQKDVPRHKDLNLEVSINLPSRNNDIKHRILWESASLLRSE
ETKKNENFEVIAKGKGEGTLSVVTMYYAKLKSQVSCQNFDLRVNIQRVPDDGKKPQDAKS
TMRLDICTRYLGPVDAAMSILDISMMTGFSPDIDDLNDLSGSVEKYFSKYELDNKLSNKN
TLILYLDKIPHEREFCISFRVHQYFNVGLVQPGSVKVYSYYNLDENCVRFYHPEKDDGLL
SKLCHQDLCRCAEENCFMHQADKVTEAYRLDKACEPGVDYVYKTRLLRKEPSEDFDDYIM
VIDQIIKSGSDEVREKEERRFISHIKCREALKLKEGKRYLMWGISSDLWGEKPNISYIIG
KDTWVELWPEAEECQDEENKKQCQELANFAEDMIVYGCPN
NT seq 4983 nt   +upstreamnt  +downstreamnt
atggggcctgccttgggccccagtctgctgctgctgctgaccagcttccccctcgtgctg
ggggatcccctgttctccgtgatcacccccaacatcctgcggctggggagcgacgagact
gtggtgctggaggcccacgactggaaagagaacattggagtcacggtcacagtccacgac
ttcccagccaagaagcaagtgctgtccaacgagagaacccagctgagcagcgccaatgac
tacctgagcacggtcaccatcaggatccccaatgacaaggatttaatatcagagagggga
aaaagttttgtgactgtccaggcggcctttggggctacagtggtggaaaaggtggtgctg
gtcagccctcagagcgggtatctcttcatccagacagacaagaccatctacacccccggc
tccacggtccactatcggatcttcaccgtggacaacaacctgctgcccgtgggtcggagt
gttatcatcgtcatccagaccccagatggtgttcccatcaagcgggacgtcttgtcttct
gtaaaccaggctggcatcttgtcgcagtcttggaacatcccggagctggtcaacatgggg
cagtggaagatccaggtccactacgaagatgccccacagcaagtcttctctgctgagttc
gaggtgaaggaatacgtgctgcccagttttgaggttcacctggagcctgaagagaaattc
tactatatcgatgacccaaagggcgtgacggtcaccatcacggccaggttcttgtacggg
aagaatgtggatggagtagccttcgtcatctttggggtccaggacggtgaccacaggatt
tctctggcccagtccctcagacgcattaagatcgacgatggcactggggaggccatgctg
agccgaaatgtcctcctaaatggggtggaaccctcccgacaagatgccttggtggggatg
tccttgtacgtgtcggtcactgttgtcttggactcaggcagcgacatggtggaggcggag
tacagcgggatccccatcgtgacctccccctaccagatccacttcaccaagacacccaag
ttcttcaaaccagccatgccctttgacctcatggtgttcgtgacaaaccctgatggctcc
ccagcccacagcgtccccgtggagatcatgggtaccgaagcccggacctcgacgcggaat
gatggtgtggccatgctgaccatgaacacacccaagaacatacagcccctgatcatcacc
gtacgcacgaagaaggacggtatcccagagcctcgacaggccaccagggaaatgaaagtc
cagccctacaatgccatgggcaacttcaaaaactacctgcatctctctgtgcctcgcttg
gagctcaaggctggggagactctcactgtcaatttccacctgcgagtggaccctagccag
gagcagtccatcacctactacacctacctgatcatgaacaaagggaagattttgactgtg
ggtcgccagaagcggcaacctggccaggacctggtcgtcatgcctctgattaccactcag
cagttcattccttccttccgcctggtggcttattacacagtcaccggcagcaacggcaag
agggaggtggtggccgattccgtgtgggtggacgtcaaggactcctgtgtgggcacgctg
gtggtgaaaggtgtcaagaagggcgaaaggccgtatcagcctggacatcagatgatgctc
aagatcgagggggacccgggggcccgagtggggctcgtggcggtggacaagggtgtgttc
gtgttgaacaagaagaacaagctgactcagagcaagatctggaacgtggtggagaacgcg
gacatcggctgcaccgcgggcagcgggcaggactacgccggggtcttcacggacgcgggg
ctggccctcaagaccaacaaagagctgcagaccgcccagaggacgaatctcgagtgcccc
aagccagccacccggcgccgccgctccgtccagctcatggagaagaggctagacaaagcc
ggccagtacccgaaggacgtgcgcatgtgctgcacgcaaggcatgcgggacaacatcatg
aagtacccctgcgagcggagggcgcagttcatcgcccacgaggagcaggagcgctgcgtg
aaggccttcctggactgctgccactacatcgcccagctgcggctcaactacagccacgac
gaacccctgggactggccaggagtgacatgaatgaggaaattttcctggaagagatcatt
tcccgaagccagttccctgagagctggctgtggaccgtagagagtctcaatgaacctgag
aaaaatggaatctccacgaagaccctgaatgtgtttttgaaagattccatcaccacttgg
gagattctggctgtgagcttgtcgaagaacaaagggatctgcgtggctgacccctatgag
gtcgtggtgatgcaagacttcttcattgacctgcggctaccctactctgtcgtgcgtaat
gagcaggtggagatccgagccgtgctctacaattaccaggaaacggagaaactcaaggtc
agggtggaactgctctacaatccagccttctgcagcctcgctaccgccaagaagcgctac
ctgcagactgtagaaatcccacccaagtcctcagtcgccgtgccttatgtcattgtgcct
ctgaagctcggcctgcatgaggtggaggtcaaggctgccgtctacaactatttaatcagc
gatggtgtcaagaagaccttgaaggtcgtgccggaaggagtcagagtcaaccagactgtg
gctgttcacacactgaatccagaagagaaaggagaagggggagagcagaaagtgcacatc
cgtgcggcagacctcagcgaccaagtcccagacacggatttggagaccaggatcgtcctg
caagggaccccggtggctcagatgacagaggacgccatcgatggggaccgtctgaagcac
ctcatcgtgaccccgtcgggctgcggggagcaaaacatgattggcatgacgcctaccgtc
atcgcggtgcattacctggaccagacggagcagtgggagaagttcagcctggagaagcgg
caagacgccttggagatcatcaagaaggggtacacccagcagctggccttcagacaaggc
aacttggccttcgcggccttcaaggaccgggcacccagcacctggttgacagcctacgtg
gtcaaggtcttctctttggccaccaacctcatcgccatcgattcccaggtcctctgtggg
gcagtcaaatggctgatcatggagaagcagaagcccgacgggatcttccacgaggatggg
ccagtgattcaccaagagatgattggtggctcccgggattctaaggagaaggaggtgtcc
ctcacagcctttgtcctcattgcactgaaagaggctgaagatatttgcgaaggacaggtc
aatagcctgccgggcagcatcaataaggcaggacagtatcttgaagcccactacgagaac
ctgcagagatcctattctgtggccattgctggctatgccctcgcccagataggcaagctg
gagggaaacctcctcagaaaattcctgaggacagccaaagacaaggaacgctgggaggag
cctaatcagaagctctatagtgtggaagccacatcctacgccctcttggccctgctgctg
ctcaaagactttgactccgtgcctcctgtcgtgcgctggctcaatgagcagagatactac
ggaggtggctatggctccacccaggccaccttcatggtattccaagccttggcccaatac
cagaaggatgtccctcgccacaaggacttgaacctggaggtgtccatcaacctgcccagc
cgaaacaatgatatcaagcaccgcatcctctgggagtctgctagcctcctgcggtcagaa
gagaccaagaaaaatgagaatttcgaagtgatagctaaaggaaaaggagaaggcaccttg
tcggtggtgacaatgtactatgccaagctcaaaagccaagtctcctgccagaactttgac
ctcagggttaacattcaacgagtccctgatgatggcaagaaacctcaggatgccaagagc
accatgcgccttgacatctgtaccaggtacctgggaccagtggatgctgccatgtcgatc
ctggatatatccatgatgactggcttttctcctgacattgatgacctcaatgatttgagc
ggcagtgtcgagaaatacttctctaagtacgagctggacaataagctgtccaataagaac
accctcatcctctacctggacaagatcccacatgagcgcgagttctgtatatccttcaga
gtgcaccagtacttcaatgtggggctggtccagcctggatcagtcaaggtctactcctat
tacaacctagatgagaactgtgtccggttctaccacccggagaaagacgacggcttactg
agcaaactctgccaccaggacttgtgtcgctgtgctgaggagaactgcttcatgcaccag
gcagacaaggtcactgaggcgtaccggctggacaaggcctgcgagccgggcgtggactac
gtgtacaagaccaggctcctcaggaaggagccctcggaagactttgacgactacatcatg
gtcatcgaccagatcatcaaatcaggctctgacgaggtgcgggaaaaggaagaacgcagg
ttcatcagccacatcaagtgcagagaagccttgaagctgaaggaggggaagcgctacctc
atgtggggcatttcctccgacctgtggggagagaaacccaacatcagctacatcatcggc
aaagacacgtgggtcgagctgtggcccgaggctgaagaatgccaggacgaggagaataag
aaacagtgccaagagttggccaacttcgcggaggacatgatcgtctacggctgtcccaac
tga

DBGET integrated database retrieval system