KEGG   Enhydra lutris kenyoni (northern sea otter): 111161960
Entry
111161960         CDS       T05871                                 

Definition
(RefSeq) induced myeloid leukemia cell differentiation protein Mcl-1 homolog isoform X1
  KO
K02539  myeloid leukemia cell differntiation protein MCL-1
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04151  PI3K-Akt signaling pathway
elk04210  Apoptosis
elk04630  JAK-STAT signaling pathway
elk05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111161960
   04151 PI3K-Akt signaling pathway
    111161960
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111161960
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    111161960
SSDB
Motif
Pfam: Bcl-2 Bcl-2_3
Other DBs
NCBI-GeneID: 111161960
NCBI-ProteinID: XP_022381765
UniProt: A0A2Y9LJA1
LinkDB
Position
Unknown
AA seq 350 aa
MFGLKRNAVIGLNLYCGGAGLGARSGGASSSGGRLLASGKEATARREVGGGEAGAVIGGS
AGASTPATLAPDARRVARPSPIGAEGPNVTATPPRLLFFEPTRRASPPEEMEGPAADAIM
SPEEELDGYEPEPLGKRPAVLPLLELVGEASSGPCTDGSLPSTPPPAEEEEDELYRQSLE
IISRYLREQATGAKDAKPLGGPGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DYVKSLSQVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVR
TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
NT seq 1053 nt   +upstreamnt  +downstreamnt
atgtttggcctcaaaagaaacgcagtaatcggactcaacctctactgtgggggggccggg
ttgggggcccgcagcggcggcgcctcctcttcgggagggcggcttttggcttcggggaag
gaggccacggcccggcgggaggtagggggaggggaagccggtgcggtgattggcggaagc
gccggcgcgagtaccccggccactctcgcgccggacgcccggagggtcgcgcggccctcg
cccattggcgccgagggccccaacgtcaccgcgacccccccgaggctgctgttcttcgag
cccacccgccgcgcgtcgccgcctgaagagatggaaggcccagctgccgacgccatcatg
tcgcccgaagaggagctggatgggtacgagccggaacctttggggaagaggcctgctgtc
ctgcctttgctggagttggtgggggaggccagcagtggcccctgcacggacggctcactg
ccctcgacgccacccccagcagaggaggaagaagacgagttgtaccggcagtccctggag
ataatctctcggtacctgcgggagcaggcaacgggcgccaaggacgcgaaaccactgggc
gggcctggggctgccagccggaaggcgttagagaccctccgacgggtcggggacggggta
cagcgcaaccacgagacggccttccaaggcatgcttcggaaactggacatcaaaaacgaa
gactatgtcaaatctttgtctcaagtgatggtccatgttttcagtgacggagtaacaaac
tggggcaggattgtgactcttatttcttttggtgcctttgtggccaaacacttgaagagt
ataaaccaagaaagctgcatcgaaccattagcagaaagcatcacagatgttctcgtaagg
acaaaacgagactggctagtcaaacaaagaggctgggatgggtttgtggagttcttccat
gtagaggacctagaaggtggcatcagaaatgtgctgctggcttttgcaggtgttgctgga
gtaggagctggtttggcatatctaataagatag

KEGG   Enhydra lutris kenyoni (northern sea otter): 111161961
Entry
111161961         CDS       T05871                                 

Definition
(RefSeq) induced myeloid leukemia cell differentiation protein Mcl-1 homolog isoform X1
  KO
K02539  myeloid leukemia cell differntiation protein MCL-1
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04151  PI3K-Akt signaling pathway
elk04210  Apoptosis
elk04630  JAK-STAT signaling pathway
elk05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111161961
   04151 PI3K-Akt signaling pathway
    111161961
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111161961
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    111161961
SSDB
Motif
Pfam: Bcl-2 Bcl-2_3
Other DBs
NCBI-GeneID: 111161961
NCBI-ProteinID: XP_022381768
UniProt: A0A2Y9LJA1
LinkDB
Position
Unknown
AA seq 350 aa
MFGLKRNAVIGLNLYCGGAGLGARSGGASSSGGRLLASGKEATARREVGGGEAGAVIGGS
AGASTPATLAPDARRVARPSPIGAEGPNVTATPPRLLFFEPTRRASPPEEMEGPAADAIM
SPEEELDGYEPEPLGKRPAVLPLLELVGEASSGPCTDGSLPSTPPPAEEEEDELYRQSLE
IISRYLREQATGAKDAKPLGGPGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DYVKSLSQVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVR
TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
NT seq 1053 nt   +upstreamnt  +downstreamnt
atgtttggcctcaaaagaaacgcagtaatcggactcaacctctactgtgggggggccggg
ttgggggcccgcagcggcggcgcctcctcttcgggagggcggcttttggcttcggggaag
gaggccacggcccggcgggaggtagggggaggggaagccggtgcggtgattggcggaagc
gccggcgcgagtaccccggccactctcgcgccggacgcccggagggtcgcgcggccctcg
cccattggcgccgagggccccaacgtcaccgcgacccccccgaggctgctgttcttcgag
cccacccgccgcgcgtcgccgcctgaagagatggaaggcccagctgccgacgccatcatg
tcgcccgaagaggagctggatgggtacgagccggaacctttggggaagaggcctgctgtc
ctgcctttgctggagttggtgggggaggccagcagtggcccctgcacggacggctcactg
ccctcgacgccacccccagcagaggaggaagaagacgagttgtaccggcagtccctggag
ataatctctcggtacctgcgggagcaggcaacgggcgccaaggacgcgaaaccactgggc
gggcctggggctgccagccggaaggcgttagagaccctccgacgggtcggggacggggta
cagcgcaaccacgagacggccttccaaggcatgcttcggaaactggacatcaaaaacgaa
gactatgtcaaatctttgtctcaagtgatggtccatgttttcagtgacggagtaacaaac
tggggcaggattgtgactcttatttcttttggtgcctttgtggccaaacacttgaagagt
ataaaccaagaaagctgcatcgaaccattagcagaaagcatcacagatgttctcgtaagg
acaaaacgagactggctagtcaaacaaagaggctgggatgggtttgtggagttcttccat
gtagaggacctagaaggtggcatcagaaatgtgctgctggcttttgcaggtgttgctgga
gtaggagctggtttggcatatctaataagatag

DBGET integrated database retrieval system