KEGG   Enhydra lutris kenyoni (northern sea otter): 111162396
Entry
111162396         CDS       T05871                                 

Definition
(RefSeq) calreticulin
  KO
K08057  calreticulin
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04141  Protein processing in endoplasmic reticulum
elk04145  Phagosome
elk04612  Antigen processing and presentation
elk05142  Chagas disease
elk05163  Human cytomegalovirus infection
elk05166  Human T-cell leukemia virus 1 infection
elk05168  Herpes simplex virus 1 infection
elk05169  Epstein-Barr virus infection
elk05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:elk00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    111162396
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    111162396
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    111162396
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111162396
   05170 Human immunodeficiency virus 1 infection
    111162396
   05168 Herpes simplex virus 1 infection
    111162396
   05163 Human cytomegalovirus infection
    111162396
   05169 Epstein-Barr virus infection
    111162396
  09174 Infectious disease: parasitic
   05142 Chagas disease
    111162396
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:elk03110]
    111162396
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:elk04091]
    111162396
Chaperones and folding catalysts [BR:elk03110]
 Other chaperones and cochaperones
  Calnexin / calreticulin
   111162396
Lectins [BR:elk04091]
 Calnexin / calreticulin
  111162396
SSDB
Motif
Pfam: Calreticulin MDM10
Other DBs
NCBI-GeneID: 111162396
NCBI-ProteinID: XP_022382497
UniProt: A0A2Y9L8K3
LinkDB
Position
Unknown
AA seq 417 aa
MLLPVPLLLGLLGLAAAEPAIYFKEQFLDGDGWTDRWIESKHKSDFGKFVLSSGKFYGDQ
EKDKGLQTSQDARFYALSARFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPDGLDQT
DMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDN
TYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTDSKPEDWDKPE
HIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYS
PDSNIYAYENFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDK
QDEEQRLKEEEEDKKRKEEEEADKEDEEDKDEDEEDEDDKEEEEEEDAAAGQAKDEL
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgctgctacccgtaccgctgctgctcggccttctcggcctggccgctgccgagcccgcc
atctactttaaggagcagtttctggacggagacgggtggaccgaccgctggatcgaatcc
aaacacaagtcagattttggcaaatttgtcctcagttccggcaagttctacggtgaccag
gagaaggataaagggctgcagacgagccaggatgcccgcttttacgctttgtcggccaga
tttgagcccttcagcaacaagggccagacactggtggtgcagttcaccgtgaaacacgag
cagaacatcgactgtgggggcggttacgtgaagctttttccagatggtctggaccagacc
gacatgcacggagactctgaatacaacatcatgttcggccccgatatctgtggccccggc
accaagaaagttcacgtcatcttcaactacaagggcaagaacgtcctgatcaacaaggac
atccgttgcaaggatgatgaattcacacacctgtataccctgattgtgcggccggataat
acctatgaggtgaagattgacaacagccaggtagaatcaggctctttggaggatgattgg
gacttcctccctcccaagaagataaaggatcccgatgcttcaaagcctgaagactgggat
gaacgggccaagattgatgatcccacagactccaagcctgaggactgggacaagcccgag
cacatccctgaccctgatgctaaaaagccagaggactgggatgaagaaatggatggagag
tgggaaccacctgtgattcagaaccctgagtacaagggcgagtggaagccccggcagatt
gacaacccagattacaagggcacttggatccacccagagattgacaaccctgagtactcc
cctgatagcaacatctatgcctatgaaaactttgctgttctgggcttagatctctggcag
gtcaagtctggcaccatctttgacaattttctcatcaccaacgatgaagcatatgcagag
gagtttggaaacgagacctggggtgtcacgaaggcggcagaaaagcagatgaaggacaag
caggacgaggagcagaggctaaaggaggaggaggaggacaagaaacgcaaggaagaggag
gaggcagacaaggaagatgaggaagacaaggatgaggatgaggaggatgaagatgacaag
gaggaagaggaagaggaagatgctgccgctggccaggccaaggatgagctgtag

DBGET integrated database retrieval system