KEGG   Enhydra lutris kenyoni (northern sea otter): 111162530
Entry
111162530         CDS       T05871                                 

Definition
(RefSeq) intercellular adhesion molecule 1
  KO
K06490  intercellular adhesion molecule 1
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk04064  NF-kappa B signaling pathway
elk04514  Cell adhesion molecules
elk04650  Natural killer cell mediated cytotoxicity
elk04668  TNF signaling pathway
elk04670  Leukocyte transendothelial migration
elk04933  AGE-RAGE signaling pathway in diabetic complications
elk05143  African trypanosomiasis
elk05144  Malaria
elk05150  Staphylococcus aureus infection
elk05164  Influenza A
elk05166  Human T-cell leukemia virus 1 infection
elk05167  Kaposi sarcoma-associated herpesvirus infection
elk05169  Epstein-Barr virus infection
elk05323  Rheumatoid arthritis
elk05416  Viral myocarditis
elk05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:elk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    111162530
   04668 TNF signaling pathway
    111162530
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    111162530
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    111162530
   04670 Leukocyte transendothelial migration
    111162530
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    111162530
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    111162530
   05416 Viral myocarditis
    111162530
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111162530
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    111162530
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111162530
   05164 Influenza A
    111162530
   05167 Kaposi sarcoma-associated herpesvirus infection
    111162530
   05169 Epstein-Barr virus infection
    111162530
  09174 Infectious disease: parasitic
   05144 Malaria
    111162530
   05143 African trypanosomiasis
    111162530
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:elk04147]
    111162530
   04090 CD molecules [BR:elk04090]
    111162530
   00536 Glycosaminoglycan binding proteins [BR:elk00536]
    111162530
   04091 Lectins [BR:elk04091]
    111162530
Exosome [BR:elk04147]
 Exosomal proteins
  Proteins found in most exosomes
   111162530
CD molecules [BR:elk04090]
 Proteins
  111162530
Glycosaminoglycan binding proteins [BR:elk00536]
 Hyaluronan
  Cell surface receptors
   111162530
Lectins [BR:elk04091]
 I-type lectins (Siglecs)
  111162530
SSDB
Motif
Pfam: ICAM_N Ig_2 Ig_3 ig I-set C2-set_2
Other DBs
NCBI-GeneID: 111162530
NCBI-ProteinID: XP_022382725
UniProt: A0A2Y9LLW1
LinkDB
Position
Unknown
AA seq 531 aa
MAPGAARLALPALLALIGVLPPGLGGAQISVHPPEATIPRGGTIQVNCSTSCDQTPTLGL
ETQLTKKEVAHGSHWKVFELSDVQEDSHPICFVNCGYQMMARMSLTVYWFPERVELLPLP
RWQPVGENFTLRCQVAGGEPRRNLTVVLLRGEEELSRQPAVGEPAEVTAPVLAGREDHLA
NFSCRTELDLRPGGLGLFQNSSAPRQLQTFVLPETQPHLATPTIVEVGTQWTVNCTLDGL
FPAAEAKVILTLAEKKLDSTSQYSKDSVLAMANVKANSQKEGIQHLACVVTLGGRDQKRE
ENVVLYSFPAPNLTLSEPEVSEGTVVTVECEAQAGTTVLLEGLSSESPAHRAEIRLNASA
ADHGRSFSCSATLIVAGQLLHKNQIRELRVLYGPRLDERDCPGNWTWEEGSQQTLQCQAW
GNPVPELKCHRKGDSALLPIGDLRPVKREVAGTYLCEARSPRGVTRREVVLNVTYHQNNM
AIIIVVAVAVLLGTVSGAAYLYNRQRKIQKYKLQKAQEAAAMKLNTPATPP
NT seq 1596 nt   +upstreamnt  +downstreamnt
atggctcccggcgccgcccgtctcgcgctgccagcgctcctcgccctgataggagttctg
cccccaggacttggaggtgcccaaatatcagtgcaccccccagaagccaccataccccga
ggaggcaccatacaggtgaactgtagtacttcctgtgaccagacccccacgctgggcctg
gagactcagttgacgaagaaggaagtggcccatgggtcccactggaaggtctttgaactg
agtgacgtacaagaagacagccatcccatatgctttgtcaactgtggctatcagatgatg
gctcgaatgtcccttaccgtgtactggttcccggagcgagtggagctgttacccctgccc
cgctggcagcccgtgggcgaaaacttcaccctgcgctgccaggtggcaggcggggagccc
cggagaaacctcaccgtggtgctgctccgcggggaggaggagctgagccggcagccggcc
gtcggggagcccgccgaggtcacggccccagtgctggcgggcagagaggaccatctcgcc
aatttctcctgccgcacggaattggacctgaggcccggagggctgggattgttccagaac
agctcggcccccaggcagctccaaacctttgtcctgccagagacccaaccacaccttgct
acccccacaattgtggaagtgggcacacagtggactgtgaactgcactctggatgggctg
ttcccagctgcggaggccaaagtcatcctgacgctagcagaaaagaaactggactctaca
tcccagtacagcaaagactctgtcttggccatggccaatgtcaaggcgaactcacaaaag
gaggggatccagcatctggcatgtgtggtgaccctaggaggtcgagaccagaagagggag
gagaacgtggtcctctacagcttccccgcgcctaacctgaccctaagtgagccagaggtc
tcagaagggactgtggtgactgtggagtgtgaggctcaggctggaaccacggtgttgctg
gaaggcctgtcatctgagtctccagcacacagagcagaaatccgattaaacgccagcgcc
gcagaccacggacgcagcttctcctgctctgctaccctgatcgtggctggacagctgttg
cacaagaaccagatccgggaactccgagtcctgtatggtccccgactagacgagagggat
tgtccgggaaactggacatgggaggaaggctcccagcagaccctgcagtgccaagcttgg
gggaacccagttcctgaactgaaatgtcaccggaagggggacagtgctttgctgcccatc
ggggacctgagacccgtcaagcgagaggttgcgggcacttacctttgtgaagcccggagc
ccccgcggggtgaccaggcgcgaagtggtcctgaacgtgacctaccaccagaataacatg
gccatcatcatcgtggtggcagttgctgtcctcttgggaactgtgagcggagccgcttac
ctctataaccgtcagcgaaagatccagaaatacaagctacagaaggcccaggaggcagct
gccatgaagctgaacacaccggccacaccgccctga

DBGET integrated database retrieval system