KEGG   Escherichia coli W: WFL_00290Help
Entry
WFL_00290         CDS       T02101                                 

Gene name
polB
Definition
(GenBank) DNA polymerase II
  KO
K02336  DNA polymerase II [EC:2.7.7.7]
Organism
ell  Escherichia coli W
Brite
KEGG Orthology (KO) [BR:ell00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ell03400]
    WFL_00290 (polB)
Enzymes [BR:ell01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     WFL_00290 (polB)
DNA repair and recombination proteins [BR:ell03400]
 Prokaryotic Type
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    WFL_00290 (polB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol_B DNA_pol_B_exo1 DNA_pol_B_2 RNase_H_2
Motif
Other DBs
NCBI-ProteinID: AFH09726
UniProt: E0IYW8
LinkDB All DBs
Structure
PDB: 

Position
complement(65232..67583)
Genome map
AA seq 783 aa AA seqDB search
MAQAGFILTRHWRDTPQGTEVSFWLATDNGPLQVTLAPQESVAFIPADQVPRAQHILQGE
QGFRLTPLALKDFHRQPVYGLYCRAHRQLMNYEKRLREGGVTVYEADVRPPERYLMERFI
TSPVWVEGDMHNGTIVNARLKPHPDYRPPLKWVSIDIETTRHGELYCIGLEGCGQRIVYM
LGPENGDASSLDFELEYVASRPLLLEKLNAWFANHDPDVIIGWNVVQFDLRMLQKHAERY
RLPLRLGRDNSELEWREHGFKNGVFFAQAKGRLIIDGIEALKSAFWNFSSFSLETVAQEL
LGEGKSIDNPWDRMDEIDRRFAEDKPALATYNLKDCELVTQIFHKTEIMPFLLERATVNG
LPVDRHGGSVAAFGHLYFPRMHRAGYVAPNLGEVPPHASPGGYVMDSRPGLYDSVLVLDY
KSLYPSIIRTFLIDPVGLVEGMAQPDPEHSTEGFLDAWFSREKHCLPEIVTNIWHGRDEA
KRQGNKPLSQALKIIMNAFYGVLGTTACRFFDPRLASSITMRGHQIMRQTKALIEAQGYD
VIYGDTDSTFVWLKGAHSEEEAAKIGRVLVQHVNAWWAETLQKQRLTSALELEYETHFCR
FLMPTIRGADTGSKKRYAGLIQEGDKQRMVFKGLETVRTDWTPLAQQFQQELYLRIFRNE
PYQEYVRETIDKLMAGELDARLVYRKRLRRPLSEYQRNVPPHVRAARLADEENQKRGRPL
QYQNRGTIKYVWTTNGPEPLDYQRSPLDYEHYLTRQLQPVAEGILPFIEDNFATLMTGQL
GLF
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcaggcaggttttatcttaacccgacactggcgggacaccccgcaagggacagaa
gtctccttctggctggcgacggacaacgggccgttgcaggttacgcttgcaccgcaagag
tccgtggcgtttattcccgccgatcaggttccccgcgctcagcatattttgcagggtgaa
caaggctttcgcctgacaccgctggcgttaaaggattttcaccgccagccggtgtatggc
ctttactgtcgcgcccatcgccaattgatgaattacgaaaagcgcctgcgtgaaggtggc
gttaccgtctacgaggccgatgtgcgcccgccagaacgctatctgatggagcggtttatc
acctcaccggtgtgggtcgagggtgatatgcacaatggcactatcgttaatgcccgtctg
aaaccgcatcccgactatcgtccgccgctcaagtgggtttctatagatattgaaaccacc
cgccacggtgagctgtactgcatcggcctggaaggctgcgggcagcgcatcgtttatatg
ctggggccggagaatggcgacgcctcctcgcttgatttcgaactggaatacgtcgccagc
cgcccgctgctgctggaaaaactcaacgcctggtttgcaaaccacgatcccgatgtgatc
atcggctggaacgtggtgcagttcgatctgcgaatgctgcaaaaacatgccgagcgttac
cgtcttccgctgcgtcttgggcgcgataatagcgagctggagtggcgcgagcacggcttt
aaaaacggcgtcttttttgcccaggctaaaggtcggctaattatcgacggtatcgaagcg
ctgaaatccgcgttctggaatttctcttcattctcgctggaaactgtcgctcaggagcta
ttaggcgaaggaaaatctatcgataacccgtgggatcgaatggacgaaattgaccgccgt
ttcgccgaagataaacctgcgctggcaacttataacctgaaagattgcgagctggtgacg
cagatcttccacaaaactgaaatcatgccatttttactcgaacgagcaacggtgaacggc
ctgccggtggatcggcacggcggttcggtggcagcgtttggtcatctctattttccgcga
atgcatcgcgctggttatgtcgcgcctaatctcggcgaagtgccaccgcacgccagccct
ggcggctacgtgatggattcacggccagggctttatgattcagtgctggtgctggactat
aaaagcctgtacccgtcgatcatccgcacctttctgattgatcccgtcgggctggttgaa
ggcatggcgcaacctgatccagagcacagtaccgaaggttttctcgatgcctggttctca
cgggagaaacattgcctgccggagattgtgactaacatctggcacgggcgcgatgaagcc
aaacgtcagggtaataagccgctttcgcaggcgctgaagatcattatgaatgccttttat
ggcgtgctcggcaccaccgcctgccgcttcttcgatccgcgcctggcatcgtcgatcacc
atgcgtggtcatcagatcatgcggcagaccaaagcattgattgaagcgcagggctacgac
gttatctacggagataccgactcgacttttgtctggctaaaaggtgcacattcggaagaa
gaggcggcgaaaatcggtcgtgtactggtgcagcacgttaacgcctggtgggcggaaacg
ctgcaaaaacaacggctgaccagcgcattagaactggagtatgaaactcatttctgccgt
tttctgatgccaaccattcgcggagccgataccggcagtaaaaagcgctacgccgggctg
attcaggagggcgataaacagcggatggtgtttaaagggctggaaaccgtgcgcaccgac
tggacgccgctggcccagcagtttcagcaggagctatacctgcgcatcttccgcaacgag
ccatatcaggaatatgtacgcgaaaccatcgacaaactgatggcgggtgaactggatgcg
cgactggtttaccgtaaacgccttcgccgtccgctgagcgagtatcagcgtaatgtgccg
cctcatgtacgcgccgctcgccttgccgatgaagaaaaccaaaagcgcggtcgccccttg
caatatcagaatcgcggcaccattaagtacgtatggaccaccaacggcccggagccgctg
gactaccaacgttcaccactggattacgaacactatctgacccgccagctacaacccgtg
gcggagggaatactcccttttattgaggataattttgctacacttatgaccgggcaactt
gggctattttga

DBGET integrated database retrieval system