KEGG   Escherichia coli W: WFL_06815Help
Entry
WFL_06815         CDS       T02101                                 

Gene name
puuE
Definition
(GenBank) 4-aminobutyrate transaminase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
ell  Escherichia coli W
Pathway
ell00250  Alanine, aspartate and glutamate metabolism
ell00410  beta-Alanine metabolism
ell00640  Propanoate metabolism
ell00650  Butanoate metabolism
ell01100  Metabolic pathways
ell01120  Microbial metabolism in diverse environments
Module
ell_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ell00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    WFL_06815 (puuE)
   00650 Butanoate metabolism
    WFL_06815 (puuE)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    WFL_06815 (puuE)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    WFL_06815 (puuE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ell01007]
    WFL_06815 (puuE)
Enzymes [BR:ell01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     WFL_06815 (puuE)
Amino acid related enzymes [BR:ell01007]
 Aminotransferase (transaminase)
  Class III
   WFL_06815 (puuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AFH11028
UniProt: E0IUV6
LinkDB All DBs
Position
1450553..1451818
Genome map
AA seq 421 aa AA seqDB search
MSNNEFHQRRLSATPRGVGVMCNFFAQSAENATLKDVEGNEYIDFAAGIAVLNTGHRHPD
LVAAVEQQLQQFTHTAYQIVPYESYVTLAEKINALAPVSGQAKTAFFTTGAEAVENAVKI
ARAHTGRPGVIAFSGGFHGRTYMTMALTGKVAPYKIGFGPFPGSVYHVPYPSDLHGISTQ
DSLDAIERLFKSDIEAKQVAAIIFEPVQGEGGFNVAPKELVAAIRRLCDEHGIVMIADEV
QSGFARTGKLFAMDHYVDKPDLMTMAKSLAGGMPLSGVVGNANIMDAPAPGGLGGTYAGN
PLAVAAAHAVLNIIDKESLCERANQLGQRLKNTLIDAKESVPAIAAVRGLGSMIAAEFND
PQTGEPSAAIAQKIQQRALAQGLLLLTCGAYGNVIRFLYPLTIPDAQFDAAMKILQDALS
D
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacaatgaattccatcagcgtcgtctttctgctaccccacgcggggttggcgtg
atgtgtaacttcttcgcccagtcggcagaaaacgctacgctgaaggacgtagagggcaac
gaatacatcgatttcgccgcaggcattgcggtgctgaataccgggcatcgccaccctgat
ctggtcgcggcggtggagcagcaattgcaacagtttacccacacggcgtatcagattgtg
ccgtacgaaagctacgtcacgctggcggagaaaattaacgcccttgccccagtgagcggg
caggctaaaaccgcattcttcactaccggcgcggaagcggtggaaaacgcggtgaaaatt
gctcgcgcccataccggacgacctggcgtgattgcgtttagcggcggcttccacggtcgt
acatatatgaccatggcgctgaccggaaaagttgcgccgtacaaaatcggcttcggcccg
ttccctggttcggtgtatcacgtaccttatccgtcagatttacacggcatttcaacacag
gactccctcgacgccatcgaacgcttgtttaaatcagacatcgaagcgaagcaggtggcg
gcgattattttcgaaccggtgcagggcgagggcggtttcaacgttgcgccaaaagagctg
gttgccgccattcgccgcctgtgcgacgagcacggcattgtgatgattgccgatgaagtg
caaagcggctttgcgcgtaccggtaaactgtttgccatggatcattacgtcgataagccg
gatttaatgacgatggcgaaaagcctcgcgggcgggatgccgctttcgggcgtggtcggt
aacgcgaatattatggacgcgcccgcgccgggcgggttgggtggcacctacgccgggaac
ccgctggcggtggctgccgcgcacgcggtgctcaatattatcgacaaagaatcactctgc
gaacgcgcgaatcaactgggccagcgtctcaaaaacacgttgattgatgccaaagaaagc
gttccggccattgctgcggtacgcggcctggggtcgatgattgcggcagagtttaacgat
ccgcaaacgggcgagccgtcagcggcgattgcacagaaaatccagcaacgcgcgctggcg
caggggctgctcctgctgacctgtggcgcatacggcaacgtgattcgcttcctgtatccg
ctgaccatcccggatgcgcaattcgatgcggcaatgaaaattttgcaggatgcgctgagc
gattaa

DBGET integrated database retrieval system