KEGG   Escherichia coli W: WFL_12305Help
Entry
WFL_12305         CDS       T02101                                 

Gene name
fabB
Definition
(GenBank) 3-oxoacyl-(acyl carrier protein) synthase I
  KO
K00647  3-oxoacyl-[acyl-carrier-protein] synthase I [EC:2.3.1.41]
Organism
ell  Escherichia coli W
Pathway
ell00061  Fatty acid biosynthesis
ell00780  Biotin metabolism
ell01100  Metabolic pathways
ell01212  Fatty acid metabolism
Module
ell_M00083  Fatty acid biosynthesis, elongation
ell_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:ell00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    WFL_12305 (fabB)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    WFL_12305 (fabB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ell01004]
    WFL_12305 (fabB)
Enzymes [BR:ell01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.41  beta-ketoacyl-[acyl-carrier-protein] synthase I
     WFL_12305 (fabB)
Lipid biosynthesis proteins [BR:ell01004]
 Fatty acid synthase
  Component type
   WFL_12305 (fabB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N KAsynt_C_assoc
Motif
Other DBs
NCBI-ProteinID: AFH12120
UniProt: E0IXZ2
LinkDB All DBs
Structure
PDB: 

Position
complement(2588655..2589875)
Genome map
AA seq 406 aa AA seqDB search
MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLI
DRKVVRFMSDASIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAM
RGPRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLG
KQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDGFVIAGGGGMVVV
EELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMKMAMHGVDTPIDYLNSHGT
STPVGDVKELAAIREVFGDKSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSIN
IEELDEQAAGLNIVTETTDRELTTVMSNSFGFGGTNATLVMRKLKD
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtgcagtgattactggcctgggcattgtttccagcatcggtaataaccagcag
gaagtcctggcatctctgcgtgaaggacgttcagggatcactttctctcaggagctgaag
gattccggcatgcgtagccacgtctggggcaacgtaaaactggataccactggcctcatt
gaccgcaaagttgtgcgctttatgagcgacgcatccatttatgcattcctttctatggag
caggcaatcgcagatgcgggcctttctccggaagcttaccagaataacccgcgcgttggc
ctgattgcaggttctggcggcggttccccgcgtttccaggtgttcggcgctgacgcaatg
cgcggcccgcgcggcctgaaagcggttggcccgtatgtggtcaccaaagcgatggcatcc
ggcgtttctgcctgcctcgccacgccgtttaaaattcatggcgttaactactccatcagc
tccgcgtgtgcgacttccgcacactgtatcggtaacgcagtagagcagatccaactgggc
aaacaggacatcgtgtttgctggcggcggcgaagagctgtgctgggaaatggcctgcgaa
ttcgacgcgatgggtgcgctgtctactaaatacaacgacaccccggaaaaagcctcccgt
acttacgacgctcaccgtgacggtttcgttatcgctggcggcggcggtatggtagtggtt
gaagagctggaacacgcgctggcgcgtggtgctcacatctatgctgaaatcgttggctac
ggcgcaacctctgatggtgcagacatggttgctccgtctggcgaaggcgcagtacgctgc
atgaagatggcgatgcacggcgttgataccccaatcgattacctgaactctcatggtact
tcgactccggttggcgacgtgaaagaactggcagctatccgtgaagtgttcggcgataag
agcccggcgatttctgcaaccaaagccatgaccggtcactctctgggcgctgctggcgta
caggaagctatctactctctgctgatgctggaacacggctttatcgccccgagcatcaac
attgaagagctggacgagcaggctgcaggtctgaacatcgtgaccgaaacgaccgatcgc
gaactgaccaccgttatgtctaacagcttcggcttcggcggcaccaacgccacgctggta
atgcgcaagctgaaagattaa

DBGET integrated database retrieval system