KEGG   Eubacterium limosum: ELI_0657Help
Entry
ELI_0657          CDS       T01336                                 

Definition
(GenBank) Shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
elm  Eubacterium limosum
Pathway
elm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
elm01100  Metabolic pathways
elm01110  Biosynthesis of secondary metabolites
elm01130  Biosynthesis of antibiotics
elm01230  Biosynthesis of amino acids
Module
elm_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:elm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ELI_0657
Enzymes [BR:elm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     ELI_0657
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 Cytidylate_kin2 AAA_33 Cytidylate_kin AAA AAA_28 AAA_22 CoaE AAA_5 AAA_24 TsaE AAA_17 Mg_chelatase AAA_16 PduV-EutP dNK AAA_7
Motif
Other DBs
NCBI-ProteinID: ADO35672
UniProt: E3GJ37
LinkDB All DBs
Position
633764..634276
Genome map
AA seq 170 aa AA seqDB search
MEKKNIALIGYMGTGKTTIGKRLASRLGLSFVDTDAYIEKQQGKSISRIFEQEGEPAFRR
MEETVLETLVEEENLLISTGGGIVLSEQNRKLLKERTFLVTLTASPGAIYSRVRGNTDRP
LLQEADPYQKIVDMLEARKPYYEIGDIIIPTDELSEKICIERIVEAYQKS
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagaagaacattgcactgatcggttatatgggaacgggcaagaccaccatcggt
aaacgcctggccagtagactgggcctgtcctttgtggataccgacgcctatattgaaaag
cagcagggaaaaagtatctcccgaatatttgagcaggagggagagccagccttcagaagg
atggaggagacagtgctggagactctggtggaagaagagaacctcttgatttcgaccggt
ggcgggattgtcctgagtgagcagaaccggaagctgctaaaagagcggaccttcctggta
accctgaccgcgtcgcctggagcgatttacagccgggtacggggaaatacggaccgcccg
ctgcttcaggaggcagatccctaccagaagattgtggatatgctggaagccaggaaaccc
tactatgagatcggcgatatcattatcccaacggatgaattatcagagaaaatttgtatt
gaacggattgtagaggcatatcaaaaaagttga

DBGET integrated database retrieval system