KEGG   Eubacterium limosum: ELI_0972Help
Entry
ELI_0972          CDS       T01336                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
elm  Eubacterium limosum
Pathway
elm00250  Alanine, aspartate and glutamate metabolism
elm00410  beta-Alanine metabolism
elm00430  Taurine and hypotaurine metabolism
elm00650  Butanoate metabolism
elm01100  Metabolic pathways
elm01110  Biosynthesis of secondary metabolites
elm01120  Microbial metabolism in diverse environments
elm02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:elm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    ELI_0972
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ELI_0972
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ELI_0972
   00430 Taurine and hypotaurine metabolism
    ELI_0972
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ELI_0972
Enzymes [BR:elm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     ELI_0972
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: ADO35975
UniProt: E3GJR7
LinkDB All DBs
Position
complement(936343..937761)
Genome map
AA seq 472 aa AA seqDB search
MLYSKDDQDKLKDRYLTPIFGTEASDEPLPKYKLRKDPVEPEVAYRLIKDDLLDEGSARL
NLSTFCQTYMEPEATKIMAETLEKNAIDKSEYPQTTELENRCVNMIADLWHAPDDEKFLG
TSTVGSSEACMLGGMAMKFRWRNNAIKQGLDVKAKKPNLVISSGYQVCWEKFCVYWDIEM
RLVPLDEQHMSMNMDTVMDFVDEYTIGIVGIMGITYTGKFDDIKALDTLVEDYNQKNPKF
PIYIHVDGASGGMFAPFIEPDLEWDFRLKNVVSINTSGHKYGLVYPGIGWVLWRDEKWLP
KELIFSVSYLGGSLPTMAINFSRSASQIIGQYYNFLRYGYEGYKKIHERTRDVAMYISKE
LEKTGLFEIYNDGSNLPIVCWKMKKDANKEWNLYDLADRIRMKGWQVPAYPLPENLQDDI
IQRVVVRADLSEQLGVLLMEDMNRAIKELDEAHILPHGGDQVNNKGVYGFTH
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgttatattcaaaagatgatcaggacaaattaaaggatcgctacttaaccccaattttt
ggtacagaagcaagtgatgaacccttacccaaatacaaacttcgcaaggacccagttgaa
ccggaggttgcttaccgcttaatcaaagatgacttattggatgaaggaagtgccagactg
aacctttccaccttctgccagacttacatggaaccagaagctacaaaaatcatggctgaa
acacttgaaaaaaatgcgattgataaatcggaataccctcagacaactgaactcgaaaac
cgttgtgtcaatatgattgctgatctgtggcatgcaccggatgatgaaaaattcttaggc
acctctaccgtaggttcttccgaagcttgtatgcttggtggtatggccatgaaattcaga
tggcgtaacaatgcgatcaagcagggcttagatgtaaaagctaaaaagccaaacctggtt
atctcctctggttatcaggtatgctgggaaaaattctgtgtgtactgggatatcgaaatg
cgtctcgtacccctggatgaacagcatatgagcatgaacatggataccgttatggatttc
gttgatgaatacaccatcggtattgtcggtatcatggggattacctacactggtaaattt
gacgacatcaaagctctggatactttagtcgaagactataaccagaaaaaccctaaattc
ccaatttacatccatgtcgacggcgcttccggcggtatgtttgcaccgtttattgaacca
gacctggaatgggacttccgtcttaaaaatgttgtttccatcaatacttccggtcataaa
tacggcttggtatatccaggtattggctgggtattatggagagatgaaaaatggttgccg
aaggaactgatcttcagcgtcagctacttaggcggcagcctgccgacaatggccattaac
ttctcacgctctgcaagccagatcattggacagtattacaacttcttacgttatggctat
gaaggctacaagaagattcacgaaagaacaagagacgttgccatgtatatctctaaagaa
ctagaaaaaaccggtttatttgaaatctacaacgatggctccaacttaccaatcgtctgc
tggaagatgaaaaaagacgcaaataaagaatggaacttatatgaccttgctgaccgtatc
cgcatgaagggctggcaggtaccggcttatccactgccggaaaacttacaggacgacatt
atccagagagtcgttgtccgtgctgacttaagtgaacagcttggcgttctgctcatggaa
gacatgaaccgcgcgatcaaggaactggacgaagcacacattctgccacatggcggcgac
caggttaacaacaagggcgtatatggttttacgcactaa

DBGET integrated database retrieval system