KEGG   Eubacterium limosum: ELI_1752Help
Entry
ELI_1752          CDS       T01336                                 

Definition
(GenBank) hypothetical protein
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
elm  Eubacterium limosum
Pathway
elm00030  Pentose phosphate pathway
elm01100  Metabolic pathways
elm01120  Microbial metabolism in diverse environments
elm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:elm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ELI_1752
Enzymes [BR:elm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     ELI_1752
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: ADO36738
UniProt: E3GMB0
LinkDB All DBs
Position
1648299..1650095
Genome map
AA seq 598 aa AA seqDB search
MNGWMGQLIRVDLEAGTIKKEPLNMQAAHDFIGARGLGTKYFCDEVDPQVDPLGPDNKMI
FMTGPLTGTAASCSGRYEVVAKAPLTGTIGASNSGGHFGPELKFAGYDGIIFENQSDRPV
YLYINDDTVELRDASDLWGKDVYETTEALEEACGEGARVACIGPTGEQGCLYSAIMNDKH
RAAGRGGMGAVMGSKKLKAVVVRGSGGVTVARPEGFMAAMTDARTKLKEHPVTGGGLPTY
GTEVLVNMINEVGGLPLRNWRDGGVYDKADDTSGEALVDSYLVKNKGCFGCSIGCGRVTR
IPDGPFKSMGEGPEYEAGWSYGADCGVNDLAAICKANFLCNQYGMDPITLGSTIACAMEL
YEKGLLSEEEIGRPLPFGDAQAMVDLTELTGKMEGFGVELAQGSYRLAEKHGAPELSMSV
KKQEMPAYDGRAVQGMALEYATSNRGGCHVRGYLTSPEVLGIPLKTDPLVTEGKAPLLKT
FQDLTAAVDSSGICLFTTFGIGLPEIAAQYREAVGSDETDEEFLLKGERIWNIEKQFNIA
AGVEKDTLPPRLLREALPEGPAKGKVAELDVMLKEYYEVRGWSTEGVPTEEKVQELGL
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgaatggatggatgggacaattaatccgcgttgatctggaagcaggaaccatcaaaaag
gaaccgcttaacatgcaggccgcccatgattttattggcgcgcgtggcctgggaacaaaa
tatttctgtgacgaggtagacccgcaggtagacccgcttggtccggataataaaatgatt
tttatgacaggaccgttgaccggtacggctgcttcctgcagcgggcggtatgaggtcgtg
gcaaaggcgcctttgacaggaaccatcggcgcttcaaactccggcggtcattttggcccc
gaactgaaatttgcaggctatgacggaattatttttgaaaaccagagtgaccgtccggtt
tacctgtatatcaatgacgacacagtggagctcagagatgcctcagacctctgggggaag
gacgtttatgaaacgaccgaagcactggaggaagcttgcggagaaggcgcgcgtgtcgcc
tgtattggcccgaccggtgaacagggctgcctgtattctgccatcatgaatgacaagcac
cgcgcagcaggccgtggtggtatgggcgctgtgatgggcagcaaaaagctaaaggctgta
gtggttcgcggaagcggcggggtaacagtggcgcggcctgaaggttttatggcagcgatg
accgatgcccgtaccaagctcaaggaacaccccgttacgggtggaggactgccgacctat
ggcactgaggttctggtcaatatgatcaacgaagtcggtggcctgccgcttcgcaactgg
cgtgacggcggtgtctatgataaggcagatgatacctctggtgaagcgctggtcgattct
tatctggttaaaaacaagggctgctttggctgctccattggctgcggccgcgtgaccaga
atcccggacgggccgtttaagtccatgggtgaaggcccagaatacgaggccggctggtcc
tatggtgcagactgtggtgtcaatgatctggctgctatctgcaaagccaatttcctctgt
aaccagtatggcatggacccgatcacacttggttctaccattgcctgtgccatggagctt
tacgaaaaggggcttctgagtgaggaagaaattggccgtccgctgccctttggcgacgca
caggccatggttgatctgacagagctcacaggaaaaatggaaggctttggtgttgagctg
gctcagggctcgtaccgcctggcagaaaaacacggtgcgccagagttgtccatgtccgtt
aaaaaacaggaaatgcccgcttatgatggacgcgctgtccaggggatggcccttgaatat
gcgacctccaaccgtggaggctgccatgtccgtggttacctgacctcacctgaggttctg
gggattccgttaaagaccgatccgcttgtgactgaaggcaaggcgccgcttctcaagacc
ttccaggatctcacagcagcggtagattccagcggcatctgcctgttcacaacctttggc
atcggcctgcctgagattgcggcgcagtaccgcgaggctgtaggctcagatgagacggat
gaggaattcctgttaaagggagaacggatctggaacattgaaaagcagtttaatattgca
gcaggtgttgagaaagatactctgccgccaagactactgcgcgaagccctgccggaaggc
ccggcaaagggcaaagtggctgagcttgacgtcatgctgaaagaatactatgaagtgcgc
ggctggagcacagaaggtgtgccaaccgaggaaaaagttcaggagcttggactttaa

DBGET integrated database retrieval system