KEGG   Eubacterium limosum: ELI_3323Help
Entry
ELI_3323          CDS       T01336                                 

Definition
(GenBank) hypothetical protein
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
elm  Eubacterium limosum
Brite
KEGG Orthology (KO) [BR:elm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:elm01001]
    ELI_3323
Enzymes [BR:elm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     ELI_3323
Protein kinases [BR:elm01001]
 Serine/threonine kinases: Other
  Bacterial family
   ELI_3323
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Kdo RIO1 Wzz Pkinase_fungal DUF5408
Motif
Other DBs
NCBI-ProteinID: ADO38285
UniProt: E3GFF1
LinkDB All DBs
Position
complement(3085628..3087382)
Genome map
AA seq 584 aa AA seqDB search
MISKVLNNRYEIIELIGRGGMAYVYKAKDRKLNRYVAVKVLREEYTENEQFIKKFDRESQ
AAAGLSHPNIVSVYDVGVEGDIYYIIMEYVDGITLKQYLNKKGHLDYKEATRFIIDVAAA
LKCAHEHKIIHRDIKPHNILLTRDLVPKVADFGIARAITSSTVTMTNQTMGSVHYISPEQ
ARGGFVDERSDLYSLGIMYYELLTGQLPFDEENTVTIAIKHIQEDLVPPKEIMPDIPASV
NDVVVKLTHKKPEDRYQNMDELIDDLEKVMVDANAAVGDNGSVVSDETQIIGDEGLFKIE
PVTGPIESGYHDDDEEEGDDLAQAQRKKKKKIIAFSIAGGILAIILIVILMNTLTAKAVM
VPNIKNMTQEQATQELEKAGLKLEVENQVYSSDVESGKIVSQNPEEGREMKKGQTVKVTV
SKGTQNVTVPKVIGLSEAEATAAIDKLKLVKNVKREYNSDVATGIVYSVDPGEGVSVAEG
TSITLYVSKGQDLVTVPGIVGLSESAAEAQIESSGLSVGRVTTSESDTVSAGLVISQSPT
EGTQTERGTSINFVVSSGKPTPSPTPTPTPTPTPTPTPTPPTNE
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgattagtaaggtcttgaacaatcgctacgagataattgaattgatcgggcgcggaggc
atggcctatgtttacaaagcaaaggaccgtaagcttaaccgttatgtagcggttaaggtt
ttgcgtgaagagtacacagaaaacgaacaattcattaagaaatttgaccgtgagtcccag
gctgctgcgggactttcccatccgaatatcgtttcagtttacgatgtgggtgtggaaggg
gatatttattatatcattatggagtatgtggatggtattaccctgaagcaatacttgaat
aaaaaagggcatctggattacaaggaagctacccgttttatcattgacgtggcagctgcg
cttaaatgcgcccatgagcataagattatccacagggatataaaacctcacaatattctt
ttaacccgcgatttggtgccaaaagttgcggattttggtattgcgagagctattaccagc
tctacggtaaccatgaccaaccagaccatgggctctgttcactatatttcacctgaacag
gcgagaggcggctttgtggatgagcgttccgacctttattcccttggcatcatgtattat
gagctgctgactggacagcttccttttgatgaggaaaatacggttaccattgccattaag
catatccaggaggatttggtgcctccaaaggaaatcatgccggatataccggccagtgtt
aatgatgttgtggtcaagctgacccataaaaagcctgaagaccgttaccagaatatggat
gaactgatcgatgatcttgaaaaggtcatggtggatgccaatgcggcagtgggcgataat
ggctctgtggtcagtgatgaaacacagattatcggtgatgaaggattattcaaaattgag
cctgttacaggaccgatcgaaagcggttatcacgacgatgatgaggaagaaggagatgat
ctggcgcaggcccagcggaagaaaaagaaaaaaatcattgctttttctatcgcaggcggt
atcttggccattattctgatcgttattctgatgaatacattgacggcaaaggcggtcatg
gttccgaacattaaaaatatgacccaggaacaggcaacccaggagctggaaaaggccgga
ttaaagctggaagttgaaaatcaggtgtacagctcagacgtagaatctggcaaaatcgtt
tctcaaaatcctgaagaaggaagagaaatgaaaaaaggacagactgtcaaggtaaccgtg
agcaagggaactcagaatgtcacagtaccaaaggttatcgggttgagtgaggcagaagcg
actgcggccatcgataagctgaagctggtcaaaaatgtcaaacgtgaatacaacagcgat
gttgccacgggcattgtctattcggttgatcctggcgaaggtgtcagtgttgctgagggc
accagcattaccctttatgtcagcaaggggcaggatcttgtaactgttcctggaattgtg
ggtttgagcgaatcggccgcagaggcgcagattgaaagcagtggactgagtgttggccgg
gtaacgaccagcgaaagcgacacggtgagcgccggtcttgttatcagccagtctcctaca
gagggaactcaaactgagcggggcacgtcaatcaattttgtagtcagcagcggtaagccg
acgccaagcccaacgccgacaccgacgccaacgccaacaccgacgccaacgccaacacca
cccacaaacgaatga

DBGET integrated database retrieval system