KEGG   Eubacterium limosum: ELI_4041Help
Entry
ELI_4041          CDS       T01336                                 

Definition
(GenBank) hypothetical protein
  KO
K02358  elongation factor Tu
Organism
elm  Eubacterium limosum
Brite
KEGG Orthology (KO) [BR:elm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:elm03012]
    ELI_4041
   03029 Mitochondrial biogenesis [BR:elm03029]
    ELI_4041
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:elm04147]
    ELI_4041
Translation factors [BR:elm03012]
 Eukaryotic Type
  Elongation factors
   ELI_4041
 Prokaryotic Type
   ELI_4041
Mitochondrial biogenesis [BR:elm03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    ELI_4041
Exosome [BR:elm04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   ELI_4041
  Exosomal proteins of breast cancer cells
   ELI_4041
  Exosomal proteins of colorectal cancer cells
   ELI_4041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ADO38985
UniProt: E3GH30
LinkDB All DBs
Position
complement(3762478..3763671)
Genome map
AA seq 397 aa AA seqDB search
MAKEKFERSKPHVNIGTIGHVDHGKTTLTAAITTVLNKRFGTGEAVAFDNIDKAPEERER
GITISTAHVEYETDARHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREH
ILLSRQVGVPYIIVFLNKADMVDDEELLELVEMEVRELLDEYEFPGDDTPIVIGSALKAL
EDPDGEWGDKIVELMKEVDAYIPEPERDTDKPFLMPVEDVFSITGRGTVATGRVERGIVH
VGDEVEIVGIHEIKKTVVTGIEMFRKLLDEGRSGDNIGALLRGIDRTMIERGQVLAKPGS
IHPHTHFTAQVYVLTKEEGGRHTPFFDGYRPQFYFRTTDVTGNIKLPEGVEMVMPGDNVE
MEITLITPIAIEEGLRFAIREGGRTVGSGAVAKIITD
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagaaaaatttgaaagatccaaaccacatgttaacattggtaccatcggtcac
gttgaccacggtaaaacaacattaaccgctgcaatcaccaccgtattaaacaaacgcttc
ggaaccggtgaagctgtagctttcgacaacatcgataaagcaccagaagaaagagaacgt
ggcatcaccatctcaaccgcccacgttgaatatgaaaccgacgcccgccactacgcacac
gtcgactgcccgggccatgccgactacgttaaaaacatgatcaccggcgcagcccagatg
gacggcgcgatcttagttgtatccgcagccgacggcccaatgccgcagacccgtgaacac
atcctgttaagccgtcaggtaggcgtaccatacatcatcgtcttcttaaacaaagccgac
atggtagatgatgaagaattattagaactggttgaaatggaagttcgtgaactgttagac
gaatacgaattcccgggagatgacacaccaatcgttatcggatccgccttaaaagcatta
gaagatccagacggcgaatggggcgacaagatcgtcgagctgatgaaagaagttgacgcg
tacatcccagaaccagaacgcgacaccgacaaaccattcttaatgccagtggaagacgta
ttctccatcaccggccgtggtaccgttgcaaccggtagagttgaacgtggtatcgtacac
gtaggggatgaagtagaaatcgttggtatccacgaaatcaagaaaaccgttgtaaccggg
attgaaatgttccgtaagctgttagatgaaggccgttcaggcgacaacatcggcgcgtta
ctgcgtgggatcgaccgtaccatgatcgaacgtggacaggtactggcaaaaccaggctcc
atccacccacacacccacttcaccgcccaggtatacgtcctgaccaaagaagaaggcggc
cgtcataccccattcttcgatggctacagaccacagttctacttcagaacaaccgacgta
accggtaatatcaaactgccagaaggtgtagaaatggttatgccaggggacaacgttgaa
atggaaatcacattgatcaccccaatcgcgatcgaagaaggtttacgtttcgcgatccgt
gaaggcggacgtaccgttggctccggagccgttgcaaaaattattacagattaa

DBGET integrated database retrieval system