KEGG   Eubacterium limosum: ELI_4118Help
Entry
ELI_4118          CDS       T01336                                 

Definition
(GenBank) hypothetical protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
elm  Eubacterium limosum
Pathway
elm00473  D-Alanine metabolism
elm00550  Peptidoglycan biosynthesis
elm01100  Metabolic pathways
elm01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:elm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    ELI_4118
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ELI_4118
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    ELI_4118
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:elm01011]
    ELI_4118
Enzymes [BR:elm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     ELI_4118
Peptidoglycan biosynthesis and degradation proteins [BR:elm01011]
 Precursor biosynthesis
  Amino acid ligase
   ELI_4118
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C DUF523 Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_4 GARS_A
Motif
Other DBs
NCBI-ProteinID: ADO39060
UniProt: E3GQ11
LinkDB All DBs
Position
complement(3838257..3839789)
Genome map
AA seq 510 aa AA seqDB search
MKRTKESTDSKLVISACLAGEACRYDGRDNLVPEFRALVEDGKAVTICPECLGGLEIPRK
PCEIRVVKGERKVYNVKNEDLTNAFKKGAEKALSLARNAGARLAVLKAKSPSCGCGCVYD
GSFHKRLVPGNGITAELFLQNGLTVMTEQEWLTQKFKEESIMEKKINLGIVFGGQSGEHE
VSRASACNVIEVIDKEKYDITLIGITKNGDWKVYTGDYKNIKDGSWEQDTDKIHADFSIF
HDPIIQDVDVFFPVLHGPMGEDGTIQGLFELMNKPYVGCGVLASAAGMDKVASKMLFESA
GIPVGPYVYFKRRDWEKDPDRIIDDIAGRGFPVFIKPSNMGSSVGISKAHNREEFIDGVN
EALRYDHKIVVEGFLNAREIECAVLEENGEIKAAIPGEVVASKEFYDYEAKYSDNQDSKI
VIPAQISDALLEKIREYAIKAFEVIDGSSLSRVDFFVTRATYNIYINEINTMPGFTNISM
YPKMWENMGVSYAELVEKLIQGAAVKRVNS
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaacaaaagaatcaacagattccaaacttgtcatcagcgcctgcctggccggg
gaggcctgccggtacgatggccgggacaacctggtgcccgagttcagggcgctggtggag
gacggaaaggcagtgaccatttgtccggaatgcctgggcggactggaaattccccgaaaa
ccctgtgaaattagggtagtcaaaggggaaaggaaagtgtataatgtaaaaaatgaagat
ttaacgaacgcctttaaaaaaggggcggaaaaagcgttatcccttgccaggaatgcgggc
gcgcggctggcggtgctcaaggcaaagagcccctcctgcgggtgcggctgtgtctatgac
ggcagtttccataaacggctggtgcctggaaatggcataacagcggagctgttcctgcaa
aacggcctgacggtcatgacagagcaggagtggctgacgcaaaaatttaaggaggaatcc
attatggagaaaaagattaatttaggcattgtattcggtggacagtctggcgaacatgag
gtgtcacgcgcctcggcctgcaatgtcattgaagtgattgacaaagaaaaatacgatatt
accctgatcggcatcaccaaaaacggtgactggaaggtctacaccggggactataaaaac
attaaggacggctcctgggagcaggatacggacaaaatccacgcggatttttccattttc
cacgatcccattatccaggatgtggatgtgttcttccccgtgcttcacggaccaatgggc
gaggacggcaccatccaaggcctctttgagctgatgaacaagccttatgtgggctgcggt
gtgctggcttccgctgctggcatggacaaggtggcctccaaaatgctttttgagagcgct
ggcatcccagtgggcccatatgtttacttcaaacgcagagactgggaaaaggatccggac
cgcatcatcgatgacatcgcaggccggggcttcccagtatttatcaagccctccaacatg
ggctccagcgtcggcatcagcaaggcacataatagggaagaattcatcgacggcgtcaac
gaagcgctccgttacgatcataaaatcgtggttgaaggcttcctgaacgcacgggaaatt
gaatgtgcggttctggaagaaaacggtgagatcaaagcagcgattcctggcgaagtggtc
gcctccaaggaattttacgattatgaagcaaaatacagcgacaaccaggactccaaaatc
gtgatccctgcacagatcagcgacgctttgctcgagaaaatccgcgaatacgccatcaag
gcctttgaggtgattgacggcagcagcctcagccgtgtagatttctttgtgacccgcgcg
acctacaacatttatatcaatgaaatcaacaccatgccaggctttaccaatatcagcatg
tacccgaaaatgtgggagaacatgggcgtttcttacgctgagctggttgaaaagctgatc
cagggcgctgcggttaagcgtgtcaacagctaa

DBGET integrated database retrieval system