KEGG   Eubacterium limosum: ELI_4330Help
Entry
ELI_4330          CDS       T01336                                 

Definition
(GenBank) alpha amylase catalytic region
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
elm  Eubacterium limosum
Pathway
elm00500  Starch and sucrose metabolism
elm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:elm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ELI_4330
Enzymes [BR:elm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     ELI_4330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 DUF1939
Motif
Other DBs
NCBI-ProteinID: ADO39270
UniProt: E3GQH8
LinkDB All DBs
Position
complement(4054211..4055653)
Genome map
AA seq 480 aa AA seqDB search
MNGTMMQYFEWYLPEDQSLWRQVAEDASHLKALGITAVWLPPAYKGAAGKSDVGYAPYDL
YDLGEFDQKGSVATKYGTVSEYCEAISALQDNGIEVYADIVLDHRLGADRTENVYACKEN
DENRNEQIEPIRPIKAWTQFDFPGRGDTYSDFKWNWTHFAGIDWDEKKEDSAVFQFQGKR
WASDVDRENGNFDYLMGADVDLNNREVVEELIRWGRWYLDKTRVNGFRMDAVKHIDFNFF
NEWLDAVRRDWDQELFAVGEYWSGDLEDLKRYMETTGRTMCLFDVPLHYHFFDASNSGDG
YDMRQLLSNTLTAHDPTRSVTFVDNHDTQPGQSLESWVQPWFKPLAYAFILLRADGYPCV
FYGDYYGIPAQNIEPMQALLDKLLCARRESAYGAQRDYFDDFHIIGWVREGDPAEPESGL
AVLMTNGDGGSKQMYMGHQFAGKDFYDITGNVEGTVTVNENGDGVFHVAPGSVSVWVRTR
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgaatggaacgatgatgcagtattttgaatggtacctgcctgaggaccagtccctgtgg
cggcaggtggcagaggatgccagtcatcttaaagcgctcgggatcacggcggtgtggctg
cctccggcctacaagggcgcggcaggtaaaagcgatgtgggctacgcgccctatgacctt
tatgatctgggtgaatttgatcagaaaggcagcgtcgccacaaaatacggaacagtcagt
gaatattgcgaagccatcagcgcccttcaggataacggaatcgaggtttacgcggatatt
gtgctggatcaccgtctgggcgcggaccggacggaaaatgtctacgcctgcaaggaaaat
gacgaaaaccggaatgagcagattgagcctatccgccccattaaggcgtggacgcagttt
gactttccaggccggggcgatacctattcggattttaaatggaactggacgcattttgcg
ggcattgactgggatgagaagaaagaggacagcgcggttttccagtttcagggcaagcgc
tgggccagtgacgtggaccgtgaaaatggcaattttgactatctgatgggcgcggacgtg
gatttaaacaaccgcgaggtggttgaggaattgatccgctggggcagatggtacctggat
aaaacccgggtcaacggtttccgtatggacgcggtcaagcacattgattttaattttttt
aatgagtggctggacgcagtcaggcgtgactgggaccaggagctgtttgccgtgggcgaa
tactggtctggcgatctggaggatctcaagcgctatatggagaccacgggccggaccatg
tgcctgtttgatgtgccgctccactatcatttttttgacgcctcgaacagcggtgacggc
tatgatatgcggcagctgttaagcaataccctgacagcccatgaccccacacggtcggtc
acctttgtggataaccacgacacgcagcccggccagtcgctggaatcctgggtacagccc
tggtttaagccgctggcctacgcttttattttgctgcgggccgacggctatccctgcgtt
ttttacggcgattattatggtattcccgcccagaacatcgagcccatgcaggcgcttttg
gacaagctgctctgtgcccggcgcgaatcggcctacggcgcccagagggattattttgac
gatttccatatcatcggatgggtgcgcgaaggtgacccggcagagccggaatccggtctg
gcagtactgatgacaaacggcgacggcggctcaaagcagatgtatatgggacatcagttt
gccggaaaggatttttatgacatcacgggcaatgtggagggcacggtcactgtcaacgaa
aacggcgacggcgtttttcacgtggcgcccggttcggtatcggtctgggtcaggacaagg
taa

DBGET integrated database retrieval system