KEGG   Escherichia coli O83 H1 NRG 857C (AIEC): NRG857_05450
Entry
NRG857_05450      CDS       T02068                                 

Definition
(RefSeq) sensor protein PhoQ
  KO
K07637  two-component system, OmpR family, sensor histidine kinase PhoQ [EC:2.7.13.3]
Organism
eln  Escherichia coli O83:H1 NRG 857C (AIEC)
Pathway
eln01503  Cationic antimicrobial peptide (CAMP) resistance
eln02020  Two-component system
Brite
KEGG Orthology (KO) [BR:eln00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    NRG857_05450
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    NRG857_05450
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:eln01001]
    NRG857_05450
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:eln02022]
    NRG857_05450
   01504 Antimicrobial resistance genes [BR:eln01504]
    NRG857_05450
Enzymes [BR:eln01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     NRG857_05450
Protein kinases [BR:eln01001]
 Histidine kinases
  OmpR family
   NRG857_05450
Two-component system [BR:eln02022]
 OmpR family
  PhoQ-PhoP (magnesium transport)
   NRG857_05450
Antimicrobial resistance genes [BR:eln01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, protease PgtE [MD:M00744]
    NRG857_05450
SSDB
Motif
Pfam: PhoQ_Sensor HATPase_c HATPase_c_5 HAMP HATPase_c_2 HisKA HATPase_c_3 OmpH
Other DBs
NCBI-GeneID: 12877900
NCBI-ProteinID: YP_006119452
UniProt: A0A0H3EIC9
LinkDB
Structure
PDB: 
1ID0 6A8U 3BQA 3BQ8 6A8V

Position
complement(1162850..1164310)
AA seq 486 aa
MKKLLHLFFPLSLRVRFLLATAAVVLVLSLAYGMVALIGYSVSFDKTTFRLLRGESNLFY
TLAKWENNKLHVELPENIDKQSPTMTLIYDENGQLLWAQRDVPWLMKMIQPDWLKSNGFH
EIEADVNDTSLLLSGDHSIQQQLQEVREDDDDAEMTHSVAVNVYPATSRMPKLTIVVVDT
IPVELKSSYMVWSWFIYVLSANLLLVIPLLWVAAWWSLRPIEALAKEVRELEEHNRELLN
PATTRELTSLVRNLNRLLKSERERYDKYRTTLTDLTHSLKTPLAVLQSTLRSLRSEKMSV
SDAEPVMLEQISRISQQIGYYLHRASMRGGTLLSRELHPVAPLLDNLTSALNKVYQRKGV
NISLDISPEISFVGEQNDFVEVMGNVLDNACKYCLEFVEISARQTDEHLYIVVEDDGPGI
PLSKREVIFDRGQRVDTLRPGQGVGLAVAREITEQYEGKIVAGESMLGGARMEVIFGRQH
SAPKDE
NT seq 1461 nt   +upstreamnt  +downstreamnt
atgaaaaaattactgcatctttttttcccgctctcgctgcgggtacgttttctgttagca
acggcagcagtagtattggtgctttcgcttgcctacggaatggttgcgctgatcggttat
agcgtcagtttcgataaaaccacgtttcggctgttacgtggcgagagcaatctgttctat
acccttgcgaagtgggaaaacaataagttgcatgtcgagttacccgaaaatatcgacaag
caaagccccacgatgacactaatttatgatgagaacgggcagcttttatgggcgcaacgt
gacgtgccctggctgatgaagatgatccagcctgactggctgaaatcgaatggttttcat
gaaattgaagcggatgttaacgataccagcctcttgctgagtggagatcattcgatacag
caacagttgcaggaagtgcgggaagatgatgacgacgcggagatgacccactcggtggcg
gtaaacgtctacccggcaacatcgcggatgccaaagttaaccattgtggtggtggatacc
attccggtggagctaaaaagttcctatatggtctggagctggtttatctatgtgctctca
gccaatctgctgttagtgatcccgctgctgtgggtcgccgcctggtggagtttacgcccc
atcgaagccctggcaaaagaagtccgcgaactggaagaacataaccgtgaattgctcaat
ccagccacaacgcgagaactgaccagtctggtacgaaacctgaaccgactgttaaaaagt
gaacgcgaacgttacgacaaatatcgtacaacgctcaccgacctgacccatagtctgaaa
acgccactggcggtgctgcaaagtacgctgcgttctctgcgtagtgagaagatgagcgtc
agtgatgctgagccggtaatgctggagcaaatcagccgcatttcacagcaaattggctac
tacctgcatcgtgccagtatgcgcggcgggacattgcttagccgcgagctgcatccggtc
gcgccactgttggacaatctcacctcggcgctgaacaaagtgtatcaacgcaaaggggtc
aatatctctctcgatatctcgccagaaatcagctttgttggtgagcagaatgattttgtc
gaagtgatgggcaacgtgctggataatgcctgtaaatattgcctcgaatttgtcgaaatt
tctgcaaggcaaaccgacgagcatctctatattgtggtcgaggatgatggccccggtatt
ccattaagcaagcgagaggtcattttcgaccgtggtcaacgggttgatactttacgccct
gggcaaggtgtggggctggcggtagcccgcgaaatcaccgagcaatatgagggtaaaatc
gtcgccggagagagcatgctgggcggtgcgcggatggaagtgatttttggtcgccagcat
tctgcgccgaaagatgaataa

DBGET integrated database retrieval system