KEGG   Escherichia coli O83 H1 NRG 857C (AIEC): NRG857_08060
Entry
NRG857_08060      CDS       T02068                                 

Definition
(RefSeq) sensor protein RstB
  KO
K07639  two-component system, OmpR family, sensor histidine kinase RstB [EC:2.7.13.3]
Organism
eln  Escherichia coli O83:H1 NRG 857C (AIEC)
Pathway
eln02020  Two-component system
Brite
KEGG Orthology (KO) [BR:eln00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    NRG857_08060
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:eln01001]
    NRG857_08060
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:eln02022]
    NRG857_08060
Enzymes [BR:eln01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     NRG857_08060
Protein kinases [BR:eln01001]
 Histidine kinases
  OmpR family
   NRG857_08060
Two-component system [BR:eln02022]
 OmpR family
  RstB-RstA
   NRG857_08060
SSDB
Motif
Pfam: HATPase_c HAMP HisKA HATPase_c_2 HATPase_c_3
Other DBs
NCBI-GeneID: 12875233
NCBI-ProteinID: YP_006119970
UniProt: A0A0H3EJA3
LinkDB
Position
1667430..1668731
AA seq 433 aa
MKKLFIQFYLLLFVCFLVMSLLVGLVYKFTAERAGKQSLDDLMNSSLYLMRSELREIPPH
DWGKTLKEMDLNLSFDLRVEPLSKYHLDDISMHRLRGGEIVALDDQYTFLQRIPRSHYVL
AVGPVPYLYYLHQMRLLDIALIAFIAISLAFPVFIWMRPHWQDMLKLEAAAQRFGDGHLS
ERIHFDEGSSFERLGVAFNQMADNINALIASKKQLIDGIAHELRTPLVRLRYRLEMSDNL
SAAESQALNRDISQLEALIEELLTYARLDRPQNELHLSEPDLPLWLSTHLADIQAVTPDK
TVRIKTLMQGHYAALDMRLMERVLDNLLNNALRYCHSTVETSLLLSGNRATLIVEDDGPG
IAPENREHIFEPFVRLDPSRDRSTGGCGLGLAIVHSIALAMGGTVNCDTSELGGARFSFS
WPLWHNIPQFTSA
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgaaaaaactgtttatccagttttacctgttattgtttgtctgcttccttgtgatgtct
ctgctggtcgggctggtgtacaaatttaccgccgaacgcgcaggcaaacagtcgctggat
gatttgatgaacagttcgctgtatctgatgcgcagcgaattgcgtgagatccccccacac
gactggggtaagacgctgaaagagatggatttaaatctctctttcgatctgcgtgtcgag
ccactgagtaaataccatcttgatgatatttccatgcaccggctgcgtggcggcgaaatt
gtcgctctggacgatcagtacacttttttgcaacgtatcccgcgcagccactacgtgctg
gcagttggtcctgttccttatctttattacctccatcagatgcgattgctggatatcgcc
ctgatcgcttttattgccatttccctcgcctttccggtgtttatctggatgcgtccgcac
tggcaggatatgttaaaactggaagcagcggcgcaacgatttggcgatgggcatctcagt
gagcgtatccactttgatgaaggttcgagctttgaacgacttggcgtcgcatttaaccag
atggcggacaatatcaacgccttgattgccagcaaaaaacagcttattgacggtatcgct
cacgaactgcgaacaccgttagtgcgcctgcgttatcgactggagatgagcgataacctg
agcgccgccgaatcccaggcgttgaatcgcgatatcagtcaacttgaagctttaattgaa
gagctgctgacttatgcccgactcgatcgcccacaaaatgagcttcatcttagcgagcca
gacctgccgttgtggctgtcaacgcatctggcagatattcaggcagtaacgcccgataaa
acggtacggataaaaacgctcatgcaaggccattatgcggcgttggatatgcgcttaatg
gagcgcgtgctggataatttgctcaataacgccctgcgctactgtcactcaacggttgaa
accagcctgctactgtcggggaatagagcgacattaattgttgaggatgatggcccaggg
attgccccagaaaaccgcgaacatatctttgaaccttttgttcgcctcgatcccagccgg
gatcgctcaaccggcggctgcgggctggggctggccattgtccactctatagcactggca
atgggcggtacggttaattgtgacaccagcgaactgggtggtgcccgcttctcgttcagc
tggccgttatggcataacatcccgcaatttacctctgcctga

DBGET integrated database retrieval system