KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_08230Help
Entry
NRG857_08230      CDS       T02068                                 

Definition
(RefSeq) transcriptional regulator SlyA
  KO
K06075  MarR family transcriptional regulator, transcriptional regulator for hemolysin
Organism
eln  Escherichia coli O83:H1 NRG 857C
Brite
KEGG Orthology (KO) [BR:eln00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:eln03000]
    NRG857_08230
Transcription factors [BR:eln03000]
 Prokaryotic Type
  Helix-turn-helix
   MarR family
    NRG857_08230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR HTH_27 MarR_2 HTH_Crp_2 B-block_TFIIIC HTH_20 HxlR HTH_5 HTH_24 TrmB DUF4423 HTH_36 LexA_DNA_bind Replic_Relax GntR RP-C GlnD_UR_UTase RsbU_N DUF2250 Fe_dep_repress
Motif
Other DBs
NCBI-GeneID: 12875267
NCBI-ProteinID: YP_006120004
UniProt: A0A0H3EHD1
LinkDB All DBs
Position
complement(1704872..1705306)
Genome map
AA seq 144 aa AA seqDB search
MESPLGSDLARLVRIWRALIDHRLKPLELTQTHWVTLHNIHQLPPDQSQIQLAKAIGIEQ
PSLVRTLDQLEEKGLISRQTCASDRRAKRIKLTEKAEPLISEMEAVINKTRAEILHGISA
EELEQLIKLIAKLEHNIIELQAKG
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
ttggaatcgccactaggttctgatctggcacggttggtgcgcatatggcgtgctctgata
gaccatcgcctgaaaccgctggagttaacacaaacccattgggttacgttacacaatatc
catcagttacctccagaccagtcgcaaattcaactggcaaaagcgattggcatcgagcag
ccatcactggtccgtacgctggaccaactggaagaaaaagggttaatttcgcgtcaaact
tgtgccagcgatcgtcgggctaaacgtattaaactgacggaaaaggcagagccattgatc
agcgaaatggaagccgttattaacaaaacccgcgcggaaattttacatggcatctccgca
gaggaactggaacaactgattaagctcatcgcaaaacttgagcataatatcattgagtta
caggccaaagggtga

DBGET integrated database retrieval system