KEGG   Escherichia coli O83 H1 NRG 857C (AIEC): NRG857_10615
Entry
NRG857_10615      CDS       T02068                                 

Definition
(RefSeq) galactitol-1-phosphate dehydrogenase
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
eln  Escherichia coli O83:H1 NRG 857C (AIEC)
Pathway
eln00052  Galactose metabolism
eln01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eln00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    NRG857_10615
Enzymes [BR:eln01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     NRG857_10615
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 2-Hacid_dh_C 3HCDH_N Shikimate_DH Methyltransf_25 UDPG_MGDP_dh_N PrmA ELFV_dehydrog FAD_binding_2 TrkA_N
Other DBs
NCBI-GeneID: 12878458
NCBI-ProteinID: YP_006120472
UniProt: A0A0H3ELU1
LinkDB
Structure
PDB: 
4UEJ 4A2C 4UEK 4UEO

Position
complement(2197645..2198685)
AA seq 346 aa
MKSVVNDTDCIVRVAESVIPEIKHQDEVRVKIASSGLCGSDLPRIFKNGAHYYPITLGHE
FSGYIDAVGSGVDDLHPGDAVACVPLLPCFTCPECLKGFYSQCAKYDFIGSRRDGGFAEY
IVVKRNNVFALPADMPIEDGAFIEPITVGLHAFHLAQGCENKNVIIIGAGTIGLLAIQCA
VALGAKSVTAIDISSEKLALAKSFGAMQTFNSREMSAPQIQGVLRDLRFNQLILETAGVP
QTVELAVEIAGPHAQLALVGTLHQDLHLTSATFGKILRKELTVIGSWMNYSSPWPGQEWE
TASRLLTERKLSLEPLIAHRGSFESFAQAVRDIARNAMPGKVLLIP
NT seq 1041 nt   +upstreamnt  +downstreamnt
atgaaatcagtggtgaatgatactgattgtatcgtgcgcgtagcagaaagcgtcattcct
gaaattaaacatcaggatgaggtgcgggtaaaaattgccagctcgggcttatgtggttcc
gatttacccaggatatttaaaaatggtgcacattattatccaataacgttaggccatgaa
tttagtggctatattgatgcggtgggatccggtgttgatgatttacaccccggcgatgcg
gttgcctgtgtgccgttattaccctgttttacttgtccagagtgtctgaaagggttttat
tcccagtgcgcaaaatatgattttattggctcacggcgtgatggtggatttgccgaatat
attgtcgttaagcgaaacaatgtctttgcactacctgcggatatgcctattgaggatggc
gcttttattgaaccgattaccgttggcctgcatgcgttccatttagcgcaaggatgtgag
aataaaaacgttattattattggtgccggaaccattggcctgctggcaattcagtgcgct
gtcgcgctgggagcaaagagtgtgacggctatcgacattagctcagaaaaactggcactg
gcaaaatctttcggtgcgatgcaaacatttaacagccgtgaaatgagcgcgccgcaaata
cagggcgttttacgcgatctgcgctttaatcagcttatcctcgagacggctggcgtcccg
caaaccgtcgaactggcggtagagattgccggtcctcatgcccaactggcgctggtaggc
acgttgcatcaggatctgcatttaacatctgcaacgtttggcaaaatattgcgtaaagag
ctgacggttatcggcagttggatgaactactccagcccttggccggggcaggagtgggaa
acggcgagccggttgctgacagaacgtaagttaagcctggagccattaatcgctcaccgt
ggaagctttgaaagcttcgcccaggcggtgcgtgacatcgctcgtaatgccatgccgggc
aaagtgttgctcattccctga

DBGET integrated database retrieval system