KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_11360Help
Entry
NRG857_11360      CDS       T02068                                 

Gene name
glpA
Definition
(RefSeq) sn-glycerol-3-phosphate dehydrogenase subunit A
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
eln  Escherichia coli O83:H1 NRG 857C
Pathway
eln00564  Glycerophospholipid metabolism
eln01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eln00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    NRG857_11360 (glpA)
Enzymes [BR:eln01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     NRG857_11360 (glpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Fer2_BFD FAD_binding_2 FAD_binding_3 FAD_oxidored DAO_C Pyr_redox_2 Thi4 3HCDH_N HI0933_like NAD_binding_8 Pyr_redox_3 Lycopene_cycl Pyr_redox GIDA
Motif
Other DBs
NCBI-GeneID: 12878609
NCBI-ProteinID: YP_006120622
UniProt: A0A0H3EMB6
LinkDB All DBs
Position
2374548..2376176
Genome map
AA seq 542 aa AA seqDB search
MKTRDSQSSDVIIIGGGATGAGIARDCALRGLRVILVERHDIATGATGRNHGLLHSGARY
AVTDAESARECISENQILKRIARHCVEPTNGLFITLPEDDLSFQATFIRACEEAGISAEA
IDPQQARIIEPAVNPALIGAVKVPDGTVDPFRLTAANMLDAKEHGAVILTAHEVTGLIRE
GATVCGVHVRNHLTGETQALHAPVVVNAAGIWGQHIAEYADLRIRMFPAKGSLLIMDHRI
NQHVINRCRKPSDADILVPGDTISLIGTTSLRIDYNEIDDNRVTAEEVDILLREGEKLAP
VMAKTRILRAYSGVRPLVASDDDPSGRNVSRGIVLLDHAERDGLDGFITITGGKLMTYRL
MAEWATDAVCRKLGNSRPCTTADTPLPGSQEPAEVTLRKVISLPAPLRGSAVYRHGDRTP
AWLSEGRLHRSLVCECEAVTAGEVQYAVENLNVNSLLDLRRRTRVGMGTCQGELCACRAA
GLLQRFNVTTSAQSIEQLSTFLNERWKGVQPIAWGDALRESEFTRWVYQGLCGLEKEQKD
AL
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactcgcgactcgcaatcaagtgacgtgattatcattggcggtggcgcaacggga
gccgggattgcccgcgactgtgccctgcgcgggctgcgcgtgattttggttgagcgccac
gacatcgcaaccggtgccaccgggcgtaaccacggcctgctgcacagcggtgcgcgctat
gcggtaaccgatgcggaatcggcccgcgaatgtattagtgaaaaccagattctgaaacgc
attgcacgtcactgcgtagaaccaaccaacggcctgtttatcaccctgccggaagatgac
ctctccttccaggccacttttatccgcgcctgcgaagaagcagggatcagcgcagaagct
atagacccgcagcaagcgcgcattatcgaacctgccgttaacccggcactgattggcgcg
gtgaaagttccggatggcaccgttgatccatttcgtctgaccgcagcaaatatgcttgat
gccaaagaacacggtgcggttatccttactgctcatgaagtcacgggactcattcgtgaa
ggcgcgacggtgtgcggcgttcatgtacgtaaccacctcaccggcgaaacccaggcactt
catgcgcctgtcgtggttaatgccgccgggatctgggggcaacatattgccgaatatgcc
gatctgcgcattcgcatgttcccggcgaaagggtcactgctgattatggatcaccgcatt
aatcagcatgtgatcaaccgctgccgcaaaccttccgacgccgatattctggtgcctggc
gataccatttcgctgattggcaccacctctttacgtattgattacaacgagattgacgat
aatcgagtgacggcagaagaagttgatattctgctgcgtgaaggggaaaaactggccccc
gtgatggcgaaaacgcgcattttgcgggcctactctggcgtacgcccgctggttgccagc
gatgacgatccgagcggacgtaacgtcagccgtggcatcgtgctgctcgaccatgctgaa
cgcgatggtctggacgggtttatcaccatcaccggtggcaaactgatgacctatcggcta
atggcggaatgggctaccgacgccgtatgccgcaaactgggcaactcgcgcccctgtacg
accgccgacacgccgttgcctggctcacaggaaccggcagaagtcacgctgcgcaaagtg
atctccctgcccgctccgctgcgcggttccgcagtttaccggcacggcgatcgcacacca
gcctggctgagcgaaggccgcctgcaccgcagcctggtatgtgagtgcgaagcggtaact
gcgggtgaagtgcagtacgcagtagaaaatttaaacgttaacagcctgctggatttacgc
cgtcgtacccgtgtagggatgggtacctgccagggcgaactctgcgcctgccgggctgcc
ggactgctgcaacgttttaacgtcacgacgtccgcgcaatctatcgagcaactttccacc
ttccttaacgaacgctggaaaggcgtgcaacccatagcatggggagacgcgctgcgcgaa
agcgaatttacccgctgggtttatcagggactgtgtggtctggagaaggagcagaaagat
gcgctttga

DBGET integrated database retrieval system