KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_13030Help
Entry
NRG857_13030      CDS       T02068                                 

Definition
(RefSeq) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
eln  Escherichia coli O83:H1 NRG 857C
Pathway
eln00250  Alanine, aspartate and glutamate metabolism
eln00280  Valine, leucine and isoleucine degradation
eln00410  beta-Alanine metabolism
eln00640  Propanoate metabolism
eln00650  Butanoate metabolism
eln01100  Metabolic pathways
eln01120  Microbial metabolism in diverse environments
Module
eln_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:eln00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    NRG857_13030
   00650 Butanoate metabolism
    NRG857_13030
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NRG857_13030
   00280 Valine, leucine and isoleucine degradation
    NRG857_13030
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NRG857_13030
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:eln01007]
    NRG857_13030
Enzymes [BR:eln01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     NRG857_13030
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     NRG857_13030
Amino acid related enzymes [BR:eln01007]
 Aminotransferase (transaminase)
  Class III
   NRG857_13030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 12877295
NCBI-ProteinID: YP_006120956
UniProt: A0A0H3ELE1
LinkDB All DBs
Structure
PDB: 

Position
2748258..2749538
Genome map
AA seq 426 aa AA seqDB search
MSSNKELMQRRSQAIPRGVGQIHPIFADRAENCRVWDVEGREYLDFAGGIAVLNTGHLHP
KVVAAVEAQLKKLSHTCFQVLAYEPYLELCEIMNQKVPGDFAKKTLLVTTGSEAVENAVK
IARAATKRSGTIAFSGAYHGRTHYTLALTGKVNPYSAGMGLMPGHVYRALYPCPLHGISE
DDAIASIHRIFKNDAAPEDIAAIVIEPVQGEGGFYAATPAFMQRLRALCDEHGIMLIADE
VQSGAGRTGTLFAMEQMGVAPDLTTFAKSIAGGFPLAGVTGRAEVMDAVAPGGLGGTYAG
NPIACVAALEVLKVFEQENLLQKANDLGQKLKDGLLAIAEKHTEIGDVRGLGAMIAIELF
EDGDHSKPDAKLTAEIVARARDKGLILLSCGPYYNVLRILVPLTIEDAQIRQGLEIISQC
FAEAKQ
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaataaagagttaatgcagcgccgcagtcaggcgattccccgtggcgttggg
caaattcacccgattttcgctgaccgcgcggaaaactgccgggtgtgggacgttgaaggc
cgtgagtatcttgatttcgcgggcgggattgcggtgctcaataccgggcacctgcatccg
aaagtggttgcggcggtggaagcgcagttgaaaaaactgtcgcacacctgcttccaggtg
ctggcttacgagccgtatcttgaactgtgcgagattatgaatcagaaggtgccgggcgat
tttgccaagaaaactctgctggttacgaccggttccgaagcggtggaaaatgcggtgaaa
atcgcccgcgccgccaccaaacgtagcgggaccatcgcctttagcggtgcgtatcacggg
cgcacgcattacacgctggcgctgaccggcaaggtgaatccgtactctgcgggcatgggg
ctgatgccgggtcatgtttatcgcgcgctttatccttgcccgctgcacggcataagcgag
gatgacgctatcgccagcatccaccggatcttcaaaaatgacgccgcgccggaagatatc
gccgccatcgtgattgagcccgttcagggcgaaggcggtttctacgccgcgacgccagcc
tttatgcagcgtttacgcgcgctgtgtgacgagcacgggatcatgctgattgccgatgaa
gtgcagagcggcgcagggcgtaccggcacgctgtttgcgatggagcaaatgggcgtggca
ccagatctcaccacctttgcgaaatcgatcgcaggcggtttcccgctggcgggcgtcacc
gggcgcgcggaagtgatggatgccgtcgctccaggcggtctgggcggcacctatgccggt
aacccgattgcctgcgtagcggcgctggaagtgttaaaagtgtttgagcaggaaaatctg
ctgcaaaaagccaacgatctggggcagaaactgaaagacggattgctggcgatagccgaa
aaacatactgagatcggcgacgtacgcgggctgggagcgatgattgccatcgagctgttt
gaagatggcgatcacagcaaaccagacgcaaaactcaccgccgagatcgtggcgcgtgcc
cgcgataagggtctgattcttctctcctgcggcccgtattacaacgtgctgcgcatcctt
gtaccgctcaccattgaagacgctcagatccgtcagggtctggaaatcatcagccagtgt
tttgctgaggcgaagcagtag

DBGET integrated database retrieval system