KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_13035Help
Entry
NRG857_13035      CDS       T02068                                 

Definition
(RefSeq) gamma-aminobutyrate transporter
  KO
K11735  GABA permease
Organism
eln  Escherichia coli O83:H1 NRG 857C
Brite
KEGG Orthology (KO) [BR:eln00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eln02000]
    NRG857_13035
Transporters [BR:eln02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   NRG857_13035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease AA_permease_2 Spore_permease
Motif
Other DBs
NCBI-GeneID: 12877296
NCBI-ProteinID: YP_006120957
UniProt: A0A0H3ENC6
LinkDB All DBs
Position
2749775..2751175
Genome map
AA seq 466 aa AA seqDB search
MGQSSQPHELGGGLKSRHVTMLSIAGVIGASLFVGSSVAIAEAGPAVLLAYLFAGLLVVM
IMRMLAEMAVATPDTGSFSTYADKAIGRWAGYTIGWLYWWFWVLVIPLEANIAAMILHSW
VPGIPIWLFSLVITLALTGSNLLSVKNYGEFEFWLALCKVIAILAFIFLGAVAISGFYPY
ADVSGISRLWDSGGFMPNGFGAVLSAMLITMFSFMGAEIVTIAAAESDTPEKHIVRATNS
VIWRISIFYLCSIFVVVALIPWNMPGLKAVGSYRSVLELLNIPHAKLIMDCVILLSVTSC
LNSALYTASRMLYSLSRRGDAPAVMGKINRSKTPYVAVLLSTGAAFLTVVVNYYAPAKVF
KFLIDSSGAIALLVYLVIAVSQLRMRKILRAEGSEIRLRMWLYPWLTWLVIGFITFVLVV
MLFRPAQQLEVISTGLLAIGIICTVPIMARWKKLIMWQKTPIHNTR
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggggcaatcatcgcaaccacatgagttaggcggcgggctgaagtcacgccacgtcacc
atgttgtctattgccggtgttatcggcgcaagtctgtttgtcggttccagcgtcgccatc
gccgaagcgggcccggcggtattactggcctatctgttcgccggattactggtggttatg
attatgcggatgttggcggaaatggcggttgccacgcccgataccggttcattttccacc
tatgccgataaagccattggccgctgggcgggctataccatcggctggttgtactggtgg
ttttgggtactggttatcccacttgaagccaacatcgccgccatgatcctgcactcgtgg
gttccaggcattcccatctggttattttccctcgtcattaccctcgccttaaccggcagt
aatttattaagcgttaaaaactacggcgaatttgagttctggctggcgctgtgtaaagtc
atcgctatcctggcctttattttccttggtgccgtcgcaattagcggtttttacccgtat
gccgacgtgagcggtatttcaagattgtgggatagcggcggctttatgcccaacggcttc
ggtgcggtattaagcgcgatgttgatcaccatgttctcgtttatgggcgcagaaattgtc
accattgccgccgcggaatccgacacgccggaaaaacatattgtccgcgccaccaactcg
gttatctggcgtatctctattttctatttgtgttctatttttgtcgttgtggcattaatc
ccgtggaatatgccagggctgaaagccgttggttcttatcgctcggttctggaattgctc
aatattcctcatgcgaaattaatcatggactgcgtgatattactttccgtaaccagctgc
ctgaactcggcgctgtataccgcttccaggatgctctactccttaagccgtcgcggtgat
gctcccgcggtaatgggtaaaatcaaccgcagtaaaaccccgtacgtggcggtgttactc
tccaccggcgcggcattcttaacggtggtggtgaactattacgcgcctgcgaaggtgttt
aaatttctgatcgacagctccggcgctatcgccctgctggtttatttagtcatcgccgtt
tcacaattgcggatgcgcaaaattctgcgagcagaaggaagcgaaattcgcctgcggatg
tggctttatccgtggctcacctggctggtcatcggctttattacctttgtgttggtagtg
atgctattccgcccggcgcaacagttagaagtgatctccaccggcttattagcgattggg
attatctgtaccgtgccaattatggctcgctggaaaaagctgataatgtggcaaaaaaca
cccattcataatacgcgctga

DBGET integrated database retrieval system