KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_16955Help
Entry
NRG857_16955      CDS       T02068                                 

Gene name
glpD
Definition
(RefSeq) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
eln  Escherichia coli O83:H1 NRG 857C
Pathway
eln00564  Glycerophospholipid metabolism
eln01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eln00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    NRG857_16955 (glpD)
Enzymes [BR:eln01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     NRG857_16955 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored Pyr_redox_2 NAD_binding_8 3HCDH_N FAD_binding_2 Lycopene_cycl GIDA
Motif
Other DBs
NCBI-GeneID: 12876275
NCBI-ProteinID: YP_006121734
UniProt: A0A0H3EMT4
LinkDB All DBs
Structure
PDB: 

Position
3573745..3575250
Genome map
AA seq 501 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLMLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKMAPHIAFPMRFRLPHRPHLRPAWMIRIGLFMYDHLGKRTSLPGS
TGLRFGANSVLKPEIKRGFEYSDCWVDDARLVLANAQMVVRKGGEVLTRTRATSARRENG
LWIVEAEDIDTGKKYTWQARGLVNATGPWVKQFFDDGMHLPSPYGIRLIKGSHIVVPRVH
TQKQAYILQNEDKRIVFVIPWMDEFSIIGTTDVEYKGDPKAVKIEESEINYLLKVYNTHF
KKQLSRDDIIWTYSGVRPLCDDESDSPQAITRDYTLDIHDEDGKAPLLSVFGGKLTTYRK
LAEHALEKLTPYYQGIGPAWTKESVLPGGAIEGDRDDYAARLRRRYPFLTESLARHYART
YGSNSELLLGNAGAISDLGENFGHEFYEAELKYLVDHEWVRRADDALWRRTKQGMWLNAD
QQSRVSQWLMEYTQQRLSLAS
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaaagatctgattgtgataggtggcggcatcaatggtgctggtatcgcggca
gacgccgctggacgcggtttatccgtgctgatgctggaggcgcaggatctcgcttgcgcg
acctcttccgccagttcaaaactcattcacggtggcctgcgctaccttgagcactatgaa
ttccgcctggtcagcgaggcgctggctgaacgtgaagtgctactgaaaatggccccgcat
atcgccttcccgatgcgttttcgcctgccgcatcgtccgcatctacgcccggcgtggatg
attcgcattggtctgtttatgtacgatcatctgggtaaacgcaccagcctgccgggatca
accggtttgcgttttggcgcaaactcagtgttaaaaccggaaattaagcgcggattcgaa
tattctgactgttgggtagacgacgcccgtctggtactcgccaacgcccagatggtggtg
cgtaaaggcggtgaagtgcttactcgtactcgtgccacgtctgctcgccgcgaaaacggc
ctgtggattgtggaggcggaagatatcgataccggcaaaaaatatacatggcaggcgcgc
ggcctggttaatgctaccggcccgtgggtgaaacaatttttcgacgacgggatgcatctg
ccttcgccttatggcattcgcctgatcaaaggcagccatattgtggtgccgcgtgtgcat
acacagaagcaagcctacattctgcaaaacgaagataaacgtattgtcttcgtgatcccg
tggatggacgagttttccatcatcggcaccaccgatgtggaatacaaaggcgatccaaaa
gcagtgaagattgaagagagtgaaatcaattacctgttgaaagtgtataacacgcacttt
aaaaagcagttaagccgggacgatatcatctggacctactccggcgtgcgtccgctatgt
gatgatgagtccgactcgccacaggccattacccgtgattacacccttgatatccatgat
gaagacggcaaagccccgctgctgtcggtattcggcggtaagctgaccacctaccgcaaa
ctggcggagcacgcgctggaaaaactgacgccatattatcagggcattggtccggcgtgg
acgaaagagagcgtgctgccgggtggtgccattgaaggcgaccgtgacgattacgccgcc
cgcctgcgccgccgttacccgttcctgaccgaatcgctggcacgtcactacgcgcgcact
tacggcagcaacagcgaactgttgctcggcaatgcaggggcgataagcgacctcggtgaa
aatttcggtcatgagttctacgaagcggagctgaaatatctggtcgaccacgaatgggtc
cgccgcgccgacgatgccctgtggcgtcgcacgaaacaaggcatgtggctaaatgcggat
caacaatctcgtgtgagtcagtggctgatggaatatacgcagcagaggttgtcgctggcg
tcgtaa

DBGET integrated database retrieval system