KEGG   Escherichia coli O83 H1 NRG 857C: NRG857_20255Help
Entry
NRG857_20255      CDS       T02068                                 

Gene name
sucA
Definition
(RefSeq) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
eln  Escherichia coli O83:H1 NRG 857C
Pathway
eln00020  Citrate cycle (TCA cycle)
eln00310  Lysine degradation
eln00380  Tryptophan metabolism
eln01100  Metabolic pathways
eln01110  Biosynthesis of secondary metabolites
eln01120  Microbial metabolism in diverse environments
eln01130  Biosynthesis of antibiotics
eln01200  Carbon metabolism
Module
eln_M00009  Citrate cycle (TCA cycle, Krebs cycle)
eln_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:eln00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NRG857_20255 (sucA)
  Amino acid metabolism
   00310 Lysine degradation
    NRG857_20255 (sucA)
   00380 Tryptophan metabolism
    NRG857_20255 (sucA)
Enzymes [BR:eln01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     NRG857_20255 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N YihI PFOR_II
Motif
Other DBs
NCBI-GeneID: 12876491
NCBI-ProteinID: YP_006122393
UniProt: A0A0H3ESU8
LinkDB All DBs
Position
4318940..4321684
Genome map
AA seq 914 aa AA seqDB search
MENMTSPGTLLSGDNATWLEEYYQTWLRTPEQLPEDWRRFFLSPELTVQSVSGDNNVSGA
TLKKQAAIIQLINAWRTQGHLRAKLDPLGLNPPADVPSLLPGFWGLSEEDLLQEFSVTFG
AHTTQMPLKQLLNLLEQAWAGSQAYELAHLENREEINWLLSRIESSNAPQADVQTCIARF
EKLMAAETLERYLHTRYVGQKRFSLEGGESAIPALDTLTKRLRAQGVEEMVIGMAHRGRL
NVLVNLLNKDPAQLFAEFEGKQTIGSGSGDVKYHMGYSSNLETPAGSLHVALAYNPSHLE
IVNPVVLGQVRARQERRGEDGQAKVVGVLIHGDSALGGLGVNQTTFNLSQTQGYGTGGTL
HLVINNQIGFTTSRLQDMRSSRYCTDIAKMVAAPIIHVNGDDVDAVCQVMELACEWRDTF
RRDIIIDICCFRKHGHNESDEPRLTQPQMYQAVDVHPGTLARYGESLARRGLLTQAQQDE
MTARYRDWLDSCQKREPQPLKPAIHSFSANWYGLTNPHWSAPVSTALPRQKLAAYGEIIS
TLPPDVVAHPTIKRQLALRQDMAAGTQPIDWGMAEMLAYASLVDAGVGVRLSGEDSGRGT
FSHRHAVVHHQTEARRYLPLQHIRAGQASFDVYDSVLNEEALLAFEYGYSTSAPQQLVIW
EAQFGDFANGAQVAIDQFISSGETKWDRYSGLTILLPHGYDGQGPEHSSARPERWLQLCA
ENNMQVVMPSESAQMFHLLRGQALRPMRKPLVIMMSKRLLRFKGAMSELCEFTDGAYKPV
ITDPQLHQSQKVKRVILCSGQVYYDVLEARKQREHEDEVAIVRLEQLYPFPVAELNDVLA
SWPNCCEWIWLQEEPENQGAWRQIRHELAALKINTPYWQYAGRPAAAAPATGYGRVHKQQ
IDEFLAAAFADIQP
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atggagaacatgacctcgcccggcacgttgcttagtggagataacgcgacctggcttgaa
gagtactaccagacctggttgcgtacgccggaacaactcccggaagactggcggcgtttt
tttctttcacctgaactgactgtccaaagcgtatccggtgataacaacgtcagcggtgcg
accttaaaaaaacaggctgcgataatacaactgatcaatgcctggcgcacgcaggggcat
ctgcgcgcaaagcttgatccacttggtttgaatcccccggctgacgttccctccctcctg
cctggtttttggggattaagcgaagaagacttgttgcaggagtttagcgtcacctttggc
gcacacaccacgcaaatgccacttaagcaactgcttaacctgctagagcaagcctgggcg
ggtagccaggcttatgaacttgctcatctggaaaatcgtgaagaaatcaactggttgtta
tcacggattgagagcagcaatgcgccacaagcagatgtacaaacctgtattgctcgtttt
gaaaaactgatggcggcagagacgttagagcgttatctgcatacccgttatgttgggcag
aaacggttttctctggaagggggagaaagtgcaatcccggcgctcgatacgctgacaaaa
cgcctgcgtgcgcaaggtgtggaggaaatggtcattggcatggcgcaccggggaagactt
aatgttctggttaatctgttgaataaagacccggcacagctttttgctgagtttgaaggc
aagcagacgatcggcagtggttcaggcgatgtgaaataccacatggggtattccagcaat
ctggaaacacctgccggttcgctgcatgtggcgctggcgtataacccctcacatctggag
atcgtgaatccggtggtgctgggccaggtgcgagccaggcaggaacgccgtggtgaggat
ggtcaggcaaaagtggtgggcgtacttattcatggggattccgcgttgggcggcctcggc
gtcaaccaaaccacgtttaacttatcgcagactcagggctacggcactggcggtacgcta
catctggtgattaacaatcagattggcttcaccacttcccgcttgcaggatatgcgttct
tcacggtactgcaccgatattgccaaaatggtagcggccccaattatccacgttaatggc
gatgacgttgacgctgtttgccaggtaatggaactggcgtgcgaatggcgagacaccttc
cggcgcgacatcatcatcgatatttgctgcttccgtaagcacggacacaacgaaagcgat
gagccacgtcttacccagccacaaatgtatcaggcagtggatgttcaccctggtacgctc
gcccgttatggtgaatctcttgcccgccgcggcctgttaactcaggcgcaacaagatgag
atgacggcacgctatcgcgactggctggatagctgccagaaacgtgaaccgcagcctctc
aaacctgcaattcactcttttagcgctaactggtatgggttgaccaaccctcactggagc
gccccggtatctacggcattgcctcggcaaaagctggcagcgtatggtgaaatcatttct
acactgccacccgatgtggtcgcacatcctaccattaaacggcaactggcgttacgccag
gatatggccgcaggtactcagccaatagactggggaatggctgaaatgctggcctatgca
tcgcttgtggatgcgggtgttggtgtgcgtctttctggtgaagactcagggcgtggcacg
ttcagtcatcgccatgcagtggtacatcatcaaactgaagcccgtcgttatctgccgtta
cagcatatccgcgctggtcaggcatctttcgatgtttatgattcggtgcttaatgaagaa
gcgctcttagcctttgaatatggctattcaacgtctgcgcctcagcaactggttatttgg
gaagcacagtttggtgactttgccaacggcgctcaggttgctattgaccagtttatctcg
tctggcgaaaccaagtgggatcgctatagcggtttaaccattcttctgccgcatggctat
gacggacaagggccggagcactcttctgcgcgtcctgagcgctggctgcaactgtgcgca
gaaaacaacatgcaggtggtgatgcccagtgagtcagcacaaatgttccatttgttgcgc
ggtcaggcattacgcccaatgcgcaaaccgttagtgataatgatgagtaagcgtttactt
cggtttaaaggcgctatgagcgagctttgtgaattcactgatggcgcttataaaccggta
atcaccgatccgcaattgcatcagtcccagaaagttaagcgcgttattttgtgtagcggc
caggtctattacgacgtactggaagcccgtaagcagcgtgagcatgaagacgaagtggcg
attgttcgcctggagcaactctacccgttcccggtcgcagaactgaatgatgttctggcg
agttggccgaactgctgcgaatggatttggttgcaggaagagccagaaaaccagggcgcg
tggcggcagattcgtcatgagctggcggcactgaaaattaacactccttactggcagtat
gcaggccgcccggcagcggcagctccggcgacagggtatgggcgtgtacataaacaacaa
atcgacgaatttcttgctgctgcgtttgcagatattcagccatga

DBGET integrated database retrieval system