KEGG   Escherichia coli O44 H18 042 (EAEC): EC042_0149Help
Entry
EC042_0149        CDS       T02067                                 

Gene name
mrcB
Definition
(GenBank) penicillin-binding protein 1B [includes: penicillin-insensitive transglycosylase; penicillin sensitive transpeptidase]
  KO
K05365  penicillin-binding protein 1B [EC:2.4.1.129 3.4.16.4]
Organism
elo  Escherichia coli O44:H18 042 (EAEC)
Pathway
elo00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:elo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EC042_0149 (mrcB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:elo01003]
    EC042_0149 (mrcB)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:elo01011]
    EC042_0149 (mrcB)
Enzymes [BR:elo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     EC042_0149 (mrcB)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     EC042_0149 (mrcB)
Glycosyltransferases [BR:elo01003]
 Polysaccharide
  Bacterial polysaccharide
   EC042_0149 (mrcB)
Peptidoglycan biosynthesis and degradation proteins [BR:elo01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   EC042_0149 (mrcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly UB2H PBP1_TM Transpeptidase UvrB_inter DUF3484
Motif
Other DBs
NCBI-ProteinID: CBG32981
UniProt: D3GR96
LinkDB All DBs
Structure
PDB: 

Position
170620..173154
Genome map
AA seq 844 aa AA seqDB search
MAGNDREPIGRKEKPTRPVKQKVSRRRYEDDDDYDDYDDYEDEEPMPRKGKGKGKGRKPR
GKRGWLWLLLKLAIVFAVLIAIYGVYLDQKIRSRIDGKVWQLPAAVYGRMVNLEPDMTIS
KNEMVKLLEATQYRQVSKMTRPGEFTVQANSIEMIRRPFDFPDSKEGQVRARLTFDGDHL
ATIVNMENNRQFGFFRLDPRLITMISSPNGEQRLFVPRSGFPDLLVDTLLATEDRHFYEH
DGISLYSIGRAVLANLTAGRTVQGASTLTQQLVKNLFLSSERSYWRKANEAYMALIMDAR
YSKDRILELYMNEVYLGQSGDNEIRGFPLASLYYFGRPVEELSLDQQALLVGMVKGASIY
NPWRNPKLALERRNLVLRLLQQQQIIDQELYDMLSARPLGVQPRGGVISPQPAFMQLVRQ
ELQAKLGDKVKDLSGVKIFTTFDSVAQDAAEKAAVEGIPALKKQRKLSDLETAIVVVDRF
SGEVRAMVGGSEPQFAGYNRAMQARRSIGSLAKPATYLTALSQPKIYRLNTWIADAPIAL
RQPNGQVWSPQNDDRRYSESGRVMLVDALTRSMNVPTVNLGMALGLPAVTETWIKLGVPK
DQLHPVPAMLLGALNLTPIEVAQAFQTIASGGNRAPLSALRSVIAEDGKVLYQSFPQAER
AVPAQAAYLTLWTMQQVVQRGTGRQLGAKYPNLHLAGKTGTTNNNVDTWFAGIDGSTVTI
TWVGRDNNQPTKLYGASGAMSIYQRYLANQTPTPLNLVPPEDIADMGVDYDGNFVCSGGM
RVLPVWTSDPQSLCQQSEMQQQPSGNPFDQSSQPQQQPQQQPAQQEQKDSDGVAGWIKDM
FGSN
NT seq 2535 nt NT seq  +upstreamnt  +downstreamnt
atggccgggaatgaccgcgagccaattggacgcaaagagaaaccgacgcgtccggtcaaa
caaaaggtaagccgtcgtcgttacgaagatgacgatgattacgacgattatgatgactat
gaggatgaagaaccgatgccgcgcaaaggtaagggcaaaggcaaagggcgtaagcctcgt
ggcaaacgcggctggctatggctgctgctaaaactggctatcgtttttgccgtgctgatc
gccatttacggcgtttatctcgatcaaaaaattcgcagccgtattgatggcaaggtctgg
caattgcccgcggcagtttatggccggatggtcaaccttgagccagacatgaccatcagc
aagaacgagatggtgaagctgctggaggcgacccagtatcgtcaggtgtcgaaaatgacc
cgtcctggcgaatttaccgtgcaggccaacagcattgagatgatccgccgtccgtttgat
ttcccggacagcaaagaagggcaggtgcgcgcgcgtctgacctttgatggcgatcatctg
gcaacgatcgtcaatatggagaacaaccgtcagttcggtttcttccgtcttgatccgcgt
ctgatcaccatgatctcttcgccaaacggtgagcagcgtctgtttgtgccgcgcagtggt
ttccctgatttgctggtggatactttgctggcgacagaagaccgtcatttctacgagcat
gatgggatcagtctctactccatcggacgtgcggtgctggcaaacctgacagccggacgc
acggtgcagggtgcgagtacgctgacgcaacagctggtgaaaaacctgttcctctccagc
gagcgctcttactggcgtaaagcgaacgaagcttacatggcgctgatcatggacgcgcgt
tacagcaaagaccgtattcttgagctgtatatgaacgaggtgtatctcggtcagagcggc
gacaacgaaatccgcggcttcccgctggcaagcttgtattactttggtcgcccggtagaa
gagctaagcctcgaccagcaggcgctgttagtcggtatggtgaaaggggcgtccatctac
aacccgtggcgtaacccgaaactggcgctggagcgacgtaatctggtgctgcgtctgctg
caacagcaacagattattgatcaagaactctatgacatgttgagtgcacgtccgctgggt
gttcagccgcgcggtggggtgatctctcctcagccagcctttatgcagctggtgcgtcag
gagttgcaggcaaaactgggcgataaggtaaaagatctctccggcgtgaagatcttcact
acctttgactcggtggcccaggacgcggcagaaaaagccgccgtggaaggcattccggca
ctgaagaaacagcgtaagttgagcgatcttgaaactgcgattgtggtcgtcgaccgcttt
agtggtgaagttcgtgcgatggtcggtggttctgagccgcagtttgcgggctacaaccgt
gcgatgcaggcgcgtcgttcgattggttcccttgcaaaaccagcgacttatctgacggct
ttaagccagccgaaaatctatcgcctgaacacgtggattgccgatgcgccaatcgcgctg
cgtcagccgaatggccaggtctggtcaccgcagaatgatgaccgtcgttatagcgaaagt
ggcagagtgatgctggtggatgcgttgacccgttcgatgaacgtgccgacggtgaatctg
gggatggcgctggggctgcctgcggttacggagacctggatcaaactgggcgtaccgaaa
gatcagctgcatccggttccggcaatgctgctgggggcgttgaacttaacgccaatcgaa
gtggcgcaggcattccagaccatcgccagcggtggtaaccgtgcaccgctttctgcgctg
cgttcggtaatcgcggaagatggcaaagtgctgtatcagagcttcccgcaggcggaacgc
gctgttccggcgcaggcggcgtatctgacactatggaccatgcagcaggttgtacaacgc
ggtacgggtcgtcagcttggggcgaaatacccgaacctgcatctggcagggaaaacaggg
actaccaacaataacgtagatacctggtttgcgggcattgacggcagcacggtgaccatc
acctgggtaggccgtgataacaaccagccgaccaaactgtatggagccagcggggcaatg
tcgatttatcagcgttatctggctaaccagacgccaacaccgctgaatcttgttccgcca
gaagatattgcagatatgggcgtggactacgacggcaactttgtttgcagcggtggcatg
cgtgtcttgccggtctggaccagcgatccgcaatcgctgtgccagcagagtgagatgcag
cagcagccgtcaggcaatccgtttgatcagtcttcacagccgcagcaacagccgcaacag
caacctgctcagcaagagcagaaagacagcgacggtgtagccggttggattaaagatatg
tttggtagtaattaa

DBGET integrated database retrieval system