KEGG   Escherichia coli O44 H18 042 (EAEC): EC042_0227
Entry
EC042_0227        CDS       T02067                                 

Definition
(GenBank) Type VI secretion system Rhs/Vgr-family protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
elo  Escherichia coli O44:H18 042 (EAEC)
Pathway
elo03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:elo00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    EC042_0227
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:elo02044]
    EC042_0227
Secretion system [BR:elo02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EC042_0227
SSDB
Motif
Pfam: Phage_GPD Phage_base_V Gp5_C DUF2345
Other DBs
NCBI-ProteinID: CBG33059
UniProt: D3GS62
LinkDB
Position
264558..266516
AA seq 652 aa
MSLKGLRFTLEIDGQEPDTFAVVHFRLIQNQSYPFVMSVDVASDSFMQTAEMLLEKKATL
TIWQGVIPLRYVTGVVAGFGMQENNGWQMRYHLRIEPPLWRCGLRQNFRIFQQQDIRTIS
ATLLNENGVTEWTPLFYEDHPAREFCVQYGESDLAFLARLWAEEGIFFFERFAADSPEQK
LTLCDDVAGLSQAGELPFNPDTSAGAETECVSMFRYEAYVRPSSVQSQDYTFKVPDWPGM
YEQQGENLNGQLEQYEIFDYPGRFKDEQHGKDFTLYQMESLRSDAEKATGQSNSPKLWPG
TRFTLTGHPQKMLNREWQVVQSILSGDQPQALHGSQGRGTTLGNQLEVIPADRTWRPRLQ
SKPKVDGPQSAIVTGPAGEEIFCDEHGRVRVQFHWDRYNPATEASSCWVRVSQAWAGPGF
GNLAIPRIGQEVIVDFLNGDPDQPIIMGRTYHEDNRSPGSLPGTKTQMTIRSKTYKGSGF
NELRFEDATDKEEIYLHAQKNMQVVVLNSKDKRVNYDRTVSIGHDESLVVANDRKVTVEG
KQDHKTTKDHVSLTEGNQGLEVKGDLAQKISGALGISVQGDIVLQSDSKISLRVGGSFVV
IHSGGVDIKGAKINLNGGGSPGDVILPMRPVILKAAAGSGTMFVAHCPKEDK
NT seq 1959 nt   +upstreamnt  +downstreamnt
atgtccttaaaaggtctgcgctttacgctggagattgacggccaggagccggacaccttt
gcagtggtgcatttcaggttaatccagaaccagtcttatccgtttgtgatgagtgtggat
gttgccagcgactcttttatgcagacggcggagatgctgctggagaagaaggcgacgctg
accatctggcagggcgtcatcccgctgcgttatgtcaccggcgtggtggcgggttttggc
atgcaggagaacaatggctggcagatgcgttatcacctgcgtattgagccgccgttatgg
cggtgcgggctgcggcagaacttccgtatcttccagcagcaggatatccggacgatatcg
gccacgttactgaacgagaacggcgtcacggagtggacaccgctgttttatgaggaccat
ccggcgcgggagttctgtgtccagtacggggaaagcgacctggcgtttctggcgcggttg
tgggcggaggagggaattttcttctttgagcggtttgcggcggacagtccggagcagaag
ctgacgctgtgcgacgatgtggcggggctgtcacaggcgggagagcttccgtttaacccg
gacacatcggcaggagcggagacagagtgtgtcagtatgttccgttatgaggcgtatgtc
cgcccgtcgtcggtgcagagccaggattacacgtttaaggtgccggactggccggggatg
tatgagcagcagggtgagaacctgaacggacagctggagcagtatgagatatttgattat
ccgggaaggttcaaggatgaacagcacggcaaggatttcacgctgtaccagatggagagc
ctgcgcagtgatgcggaaaaggccacagggcagagtaattcaccgaagctgtggccggga
acgcggtttacgctgacggggcatccgcagaagatgctgaaccgtgaatggcaggtggta
cagagtattctgtcaggggaccagccgcaggcgctgcacggcagccaggggagaggaacc
acgctgggaaatcagttagaggtgataccggcggaccggacgtggcgtccacggctgcaa
agcaaaccgaaggtggacgggccacagagcgccattgtcaccggtcctgcgggagaggaa
atcttctgcgacgaacacggacgtgtgcgagtgcagtttcactgggacaggtataacccg
gcaacggaggcgagttcatgctgggtgagggtgtcgcaggcgtgggcggggccgggattt
ggtaacctggcgataccgcgcatcggccaggaagtgattgtagacttcctgaacggcgac
ccggaccagccgataatcatggggcggacgtaccatgaggacaaccgttcgccggggagt
ctgccggggacgaagacgcagatgacgatacggtcgaagacctataaaggaagcggcttt
aatgaactgcggttcgaggacgcgacggacaaggaagaaatttacctgcacgcacagaaa
aatatgcaagtcgttgtgctgaacagcaaggataagcgggtcaactatgaccggacggtc
agcatcgggcatgatgaatccctggtggtggcaaatgaccggaaagtgacggttgaaggt
aaacaggaccataaaaccaccaaagaccatgtcagcctgacagagggcaatcaggggctg
gaggtgaaaggcgatctggcacagaaaataagcggcgcgctgggtatcagcgtacagggc
gatattgttttacagagcgacagcaaaatcagtctgcgggtgggcggttcatttgtggtg
atccattccggcggcgtggatattaagggcgcgaaaatcaatcttaacggcggaggcagt
ccgggagacgtgatcctgccgatgcgcccggtgatcctgaaagccgcagccggaagcggg
acaatgtttgtggcgcactgcccgaaggaggataagtga

DBGET integrated database retrieval system