KEGG   Escherichia coli O44 H18 042 (EAEC): EC042_1200
Entry
EC042_1200        CDS       T02067                                 

Gene name
phoQ
Definition
(GenBank) two-component sensor kinase
  KO
K07637  two-component system, OmpR family, sensor histidine kinase PhoQ [EC:2.7.13.3]
Organism
elo  Escherichia coli O44:H18 042 (EAEC)
Pathway
elo01503  Cationic antimicrobial peptide (CAMP) resistance
elo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:elo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    EC042_1200 (phoQ)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    EC042_1200 (phoQ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:elo01001]
    EC042_1200 (phoQ)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:elo02022]
    EC042_1200 (phoQ)
   01504 Antimicrobial resistance genes [BR:elo01504]
    EC042_1200 (phoQ)
Enzymes [BR:elo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     EC042_1200 (phoQ)
Protein kinases [BR:elo01001]
 Histidine kinases
  OmpR family
   EC042_1200 (phoQ)
Two-component system [BR:elo02022]
 OmpR family
  PhoQ-PhoP (magnesium transport)
   EC042_1200 (phoQ)
Antimicrobial resistance genes [BR:elo01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, protease PgtE [MD:M00744]
    EC042_1200 (phoQ)
SSDB
Motif
Pfam: PhoQ_Sensor HATPase_c HATPase_c_5 HAMP HATPase_c_2 HisKA HATPase_c_3 OmpH
Other DBs
NCBI-ProteinID: CBG34018
UniProt: D3H1U6
LinkDB
Structure
PDB: 
1ID0 6A8U 3BQA 3BQ8 6A8V

Position
complement(1280751..1282211)
AA seq 486 aa
MKKLLRLFFPLSLRVRFLLATAAVVLVLSLAYGMVALIGYSVSFDKTTFRLLRGESNLFY
TLAKWENNKLHVELPENIDKQSPTMTLIYDENGQLLWAQRDVPWLMKMIQPDWLKSNGFH
EIEADVNDTSLLLSGDHSIQQQLQEVREDDDDAEMTHSVAVNVYPATSRMPKLTIVVVDT
IPVELKSSYMVWSWFIYVLSANLLLVIPLLWVAAWWSLRPIEALAKEVRELEEHNRELLN
PATTRELTSLVRNLNRLLKSERERYDKYRTTLTDLTHSLKTPLAVLQSTLRSLRSEKMSV
SDAEPVMLEQISRISQQIGYYLHRASMRGGTLLSRELHPVAPLLDNLTSALNKVYQRKGV
NISLDISPEISFVGEQNDFVEVMGNVLDNACKYCLEFVEISARQTDEHLYIVVEDDGPGI
PLSKREVIFDRGQRVDTLRPGQGVGLAVAREITEQYEGKIVAGESMLGGARMEVIFGRQH
SAPKDE
NT seq 1461 nt   +upstreamnt  +downstreamnt
atgaaaaaattactgcgtctttttttcccgctctcgctgcgggtacgttttctgttagca
acggcagcagtagtattggtgctttcgcttgcctacggaatggttgcgctgatcggttat
agcgtcagtttcgataaaaccacgtttcggctgttacgtggcgagagcaatctgttctat
acccttgcgaagtgggaaaacaataagttgcatgtcgagttacccgaaaatatcgacaag
caaagccccactatgacgctaatttatgatgagaacgggcagcttttatgggcgcaacgt
gacgtgccctggctgatgaagatgatccagcctgactggctgaaatcgaatggttttcat
gaaattgaagcggatgttaacgataccagcctcttgctgagtggagatcattcgatacag
caacagttgcaggaagtgcgggaagatgatgacgacgcggagatgacccactcggtggcg
gtaaacgtctacccggcaacatcgcggatgccaaagttgaccattgtggtggtggatacc
attccggtggagctaaaaagttcctatatggtctggagctggtttatctatgtgctctca
gccaatctgctgttagtgatcccgctgctgtgggtcgccgcctggtggagtttacgcccc
atcgaagccctggcaaaagaagtccgcgaactggaagaacataaccgcgaattgctcaat
ccagccacaacgcgagaactgaccagtctggtacgaaacctgaaccgattgttaaaaagt
gaacgcgaacgttacgacaaatatcgtacgacgctcaccgacctgacccatagtctgaaa
acgccactggcggtgctgcaaagtacgctgcgttctctgcgtagtgagaagatgagcgtc
agtgatgctgaaccggtaatgctggagcaaatcagccgcatttcacagcaaattggctac
tacctgcatcgtgccagtatgcgcggcgggacattgctcagccgcgagctgcatccggtc
gccccactgctggacaatctcacctcggcgctgaacaaagtgtatcaacgcaaaggggtc
aatatctctctcgatatttcgccagagatcagctttgtcggtgagcagaacgattttgtc
gaggtgatgggcaacgtgctggataatgcctgtaaatattgcctcgagtttgtcgaaata
tctgcaaggcaaacagacgagcatctctatattgtggtcgaggatgatggccccggtatt
ccattaagcaagcgagaggtcattttcgaccgtggtcaacgggttgatactttacgccct
gggcaaggtgtagggctggcggtagcccgcgaaatcaccgagcaatatgagggtaaaatc
gtcgccggagagagcatgctgggcggtgcgcggatggaggtgatttttggtcgccagcat
tctgcgccgaaagatgaataa

DBGET integrated database retrieval system