KEGG   Escherichia coli O44 H18 042 (EAEC): EC042_1430Help
Entry
EC042_1430        CDS       T02067                                 

Gene name
puuE
Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
elo  Escherichia coli O44:H18 042 (EAEC)
Pathway
elo00250  Alanine, aspartate and glutamate metabolism
elo00410  beta-Alanine metabolism
elo00640  Propanoate metabolism
elo00650  Butanoate metabolism
elo01100  Metabolic pathways
elo01120  Microbial metabolism in diverse environments
Module
elo_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:elo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    EC042_1430 (puuE)
   00650 Butanoate metabolism
    EC042_1430 (puuE)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    EC042_1430 (puuE)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    EC042_1430 (puuE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:elo01007]
    EC042_1430 (puuE)
Enzymes [BR:elo01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     EC042_1430 (puuE)
Amino acid related enzymes [BR:elo01007]
 Aminotransferase (transaminase)
  Class III
   EC042_1430 (puuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: CBG34253
UniProt: D3H3K9
LinkDB All DBs
Position
1501062..1502327
Genome map
AA seq 421 aa AA seqDB search
MSNNEFHQRRLSATPRGVGVMCNFFAQSAENATLKDVEGNEYIDFAAGIAVLNTGHRHPD
LVAAVEQQLQQFTHTAYQIVPYESYVTLAEKINALAPVSGQAKTAFFTTGAEAVENAVKI
ARAHTGRPGVIAFSGGFHGRTYMTMALTGKVAPYKIGFGPFPGSVYHVPYPSDLHGVSTQ
DSLDAIERLFKSDIEAKQVAAIIFEPVQGEGGFNVAPKELVAAIRRLCDEHGIVMIADEV
QSGFARTGKLFAMDHYADKPDLMTMAKSLAGGMPLSGVVGNANIMDAPAPGGLGGTYAGN
PLAVAAAHAVLNIIDKESLCERANQLGQRLTNTLIDAKESVPAIAAVRGLGSMIAAEFND
PQTGEPSAAIAQKIQQRALAQGLLLLTCGAYGNVIRFLYPLTIPDAQFDAAMKILQDALN
D
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacaatgaattccatcagcgtcgtctttctgctaccccacgcggggttggcgtg
atgtgtaacttcttcgcccagtcggcagaaaacgctacgctgaaggacgtagagggcaac
gaatacatcgatttcgccgcaggcattgcggtgctgaataccgggcatcgccaccctgat
ctggtcgcggcggtggagcagcaattgcaacagtttacccacacggcgtatcagattgtg
ccgtacgaaagctacgtcaccctggcggagaaaattaacgcccttgccccggtgagcggg
caggctaaaactgcgttcttcaccaccggtgcggaagcggttgagaacgcggtgaaaatc
gcccgcgcccataccggacgccctggcgtgattgcgtttagcggcggcttccacggtcgt
acatatatgaccatggcgctgaccggaaaggtcgcgccatacaaaatcggcttcggcccg
ttccccggttcggtatatcacgtaccttatccgtcagatttacatggcgtttcaacgcag
gactctctcgacgccatcgaacgcttgtttaaatcggacattgaagcgaagcaggtggcg
gcgattattttcgaaccggtgcagggcgaaggcggtttcaacgttgcaccaaaagagctg
gttgccgccattcgccgcctgtgcgacgagcacggcattgtgatgattgccgatgaagtg
caaagcggctttgcgcgtaccggtaaactgtttgccatggatcactacgccgataagccg
gacttaatgacgatggcgaaaagcctcgcaggcggcatgccgctttcgggcgtggtcggt
aacgcgaatattatggacgcgcccgcgccgggcgggttgggtggtacttacgccgggaac
ccgctggcggtggctgccgcgcacgctgtgctcaacattatcgacaaagaatcactctgt
gaacgcgcgaatcaactgggccagcgcctgacaaacacgttgattgatgccaaagaaagc
gttccggccatcgcggcggtacgcggtctggggtctatgattgcggcagagtttaacgat
ccgcaaacgggcgagccgtcagcggcgattgcacagaaaatccagcaacgcgcgctggcg
caggggctgcttctgctgacctgtggcgcatacggcaacgtgattcgtttcctgtatccg
ctgaccatcccggatgcgcaattcgatgcggcaatgaaaattttgcaggatgcgctgaac
gattaa

DBGET integrated database retrieval system