KEGG   Escherichia coli O44 H18 042 (EAEC): EC042_1585
Entry
EC042_1585        CDS       T02067                                 

Definition
(GenBank) Type VI secretion system Rhs/Vgr-family protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
elo  Escherichia coli O44:H18 042 (EAEC)
Pathway
elo03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:elo00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    EC042_1585
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:elo02044]
    EC042_1585
Secretion system [BR:elo02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EC042_1585
SSDB
Motif
Pfam: Phage_GPD Phage_base_V Gp5_C
Other DBs
NCBI-ProteinID: CBG34410
UniProt: D3GRI9
LinkDB
Position
1653397..1655802
AA seq 801 aa
MSLKGLRFTLEVDGQEPDTFAVVNFRLIQNQSYPFVMSVDVASDSFMQTAEMLLEKKATL
TIWQGAVAQRYVTGVVAGFGMQENNGWQMRYHLRIEPPLWRCGLRQNFRIFQQQDIRTIS
ATLLNENGVTEWTPLFYEDHPAREFCVQYGESDLAFLSRLWAEEGLFFFERFAADSPEQK
LTLCDDVAGLSQAGEFPFNPDTSAGAETECVSMFRYEAHVRPSSVQSQDYTFKVPDWPGM
YEQQGENLNGQLEQYEIFDYPGRYKDEQHGKDFTLYQMESLRSDAEKATGQSNSPKLWPG
TRFMLTGHPQKMLNREWQVVQSILSGNQPQALHGSQGKGTTLGNQLEVIPADRTWRPRLQ
NKPKVDGPQSAIVTGPAGEEIFCDEHGRVRVKFHWDRYHGMTEASSCWVRVSQAWAGPGF
GNLAIPRVGQEVIVDFLNGDPDQPIIMGRTYHEDNRSPGDLPGTKTQMTIRSKTYKGSGF
NELRFEDATSNEQVYIHAQKNMDTEVLNDRTTDVKHDHTETIGNDQKITVVKGQTVQVGT
RKEGGHDQSITVANDRCITVRNDQTLQVTNDRTVSVSNDDGLYVRNDRKVTVEGKQEHKT
TGNHISLVEGKHSLVVKGDLARKVSGALGIKVDGDIVLESSSRISLKVSGSFVVIHSGGV
DIVGPKINLNSGGSPGTPVPALQPAVLKTLGDEKSGDGSDSGEENEDSGGNCVTGSGGDD
RGDDEDEPEKYTLQFHFTDDDGIPYSETRYIAFFEDGTQTRGETDEEGYTERFFVSSKHE
IKVKLLFANDDFLSMEGHYGR
NT seq 2406 nt   +upstreamnt  +downstreamnt
atgtccttaaaaggtcttcgctttacgctggaggttgacggccaggagccggacaccttt
gcagtggtgaatttcaggttaatccagaaccagtcatatccgtttgtgatgagtgtggat
gttgccagcgactcttttatgcagacggcggagatgctgctggagaagaaggcgacactg
accatctggcagggcgcagtggcgcagcgttatgtcaccggcgtggtggcgggttttggc
atgcaggagaataacggctggcagatgcgttatcacctgcgtattgagccgccgttatgg
cggtgcgggctgcggcagaactttcgtatcttccagcagcaggatatccggacgatatcg
gccacgttactgaacgagaacggcgtcacggagtggacgccgctgttttatgaggaccat
ccggcgcgggagttctgtgtccagtacggggagtcggacctggcgtttctgtcccggctg
tgggcggaggagggtcttttcttctttgagcggtttgcggcggacagtccggagcagaag
ctgacgctgtgcgacgatgtggcggggctgtcacaggcgggggagtttccgtttaacccg
gacacatcggcaggtgcggagacggagtgtgtcagtatgttccgttatgaggcgcatgtc
cgcccgtcatcggtgcagagccaggattacacctttaaggtgccggactggccggggatg
tatgagcagcagggtgagaacctgaacggacagctggagcagtatgagatatttgattat
ccgggaaggtacaaggatgaacagcacggcaaggatttcacgctgtaccagatggagagc
ctgcgcagtgatgcggaaaaggccacagggcagagtaattcgccgaagctgtggccggga
acgcggtttatgctgacggggcatccgcagaagatgctgaaccgtgaatggcaggtggta
cagagcatactgtcaggaaaccagccgcaggcgctgcacggcagccagggaaagggaacc
acgctgggcaatcagttagaggtgataccggcggaccggacgtggcgtccacggctgcaa
aacaaaccgaaggtggacgggccacagagcgccatcgtcaccggtcctgcgggagaggaa
atcttctgcgatgaacatggacgggtacgggtgaagttccactgggaccgttatcacggg
atgacggaggcgagttcatgctgggtgcgggtatcgcaggcgtgggcggggccggggttc
ggtaacctggcgataccacgggtgggtcaggaggtgatagtggacttcctgaacggcgac
ccggaccagccgataatcatggggcggacgtaccatgaggacaaccgttcgccgggcgac
ctgccgggaacgaagacgcagatgaccatccggtcaaaaacctataaaggaagcggattt
aacgagctgcggtttgaagacgccaccagtaatgagcaggtgtatatccatgcccagaag
aacatggatacggaggtgctcaacgaccggacaacggatgtgaaacatgaccatacggaa
accatcgggaacgaccagaagataacggtggtgaaggggcagacggttcaggtcgggacc
agaaaagaagggggccacgaccagagtatcacggtggcgaacgaccggtgcatcacggta
cgtaatgaccagacgctgcaggtgacgaatgaccggacggtgagcgtgagtaatgatgac
ggcctgtacgtcagaaatgaccgtaaagtgacggtggaagggaagcaggagcataagacg
acggggaaccatatcagtctggtggagggaaagcacagcctggtggtgaagggggacctg
gcgaggaaggtgagtggcgcgctggggataaaggtggacggggatatcgtgctggagagc
agcagccggataagcctgaaggtgagtggctcgtttgtggtcatccattcagggggcgtg
gacatcgtcgggccgaaaatcaatctcaatagcggcggtagtccggggacgccggtgccg
gcgctgcaaccggcggtgctgaagacactgggggatgagaagagtggtgatggcagtgat
tccggagaagaaaatgaagactctggagggaactgcgtgaccggaagtggtggtgatgat
cgaggtgacgatgaggatgaacctgaaaaatatactctccagttccattttacagacgat
gacgggataccgtattcagaaacccgctacattgccttctttgaggatggcacgcagacc
cgcggagaaacggatgaagaggggtatacagagcgtttttttgtatctagcaaacatgaa
attaaagtgaagttgttatttgcgaatgatgattttctctcaatggaaggacactatgga
cgataa

DBGET integrated database retrieval system