KEGG   Escherichia coli O44 H18 042 (EAEC): EC042_1608Help
Entry
EC042_1608        CDS       T02067                                 

Gene name
fdnI
Definition
(GenBank) formate dehydrogenase, nitrate-inducible, cytochrome b556(fdn) subunit
  KO
K08350  formate dehydrogenase-N, gamma subunit
Organism
elo  Escherichia coli O44:H18 042 (EAEC)
Pathway
elo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:elo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    EC042_1608 (fdnI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ni_hydr_CYTB DUF4405
Motif
Other DBs
NCBI-ProteinID: CBG34430
UniProt: D3GRK9
LinkDB All DBs
Structure
PDB: 

Position
1680242..1680895
Genome map
AA seq 217 aa AA seqDB search
MSKSKMIVRTKFIDRACHWTVVICFFLVALSGISFFFPTLQWLTQTFGTPQMGRILHPFF
GIAIFVALMFMFVRFVHHNIPDKKDIPWLLNIVEVLKGNEHKVADVGKYNAGQKMMFWSI
MSMIFVLLVTGVIIWRPYFAQYFPIQVVRYSLLIHAAAGIILIHAILIHMYMAFWVKGSI
KGMIEGKVSRRWAKKHHPRWYREIEKAEAKKESEEGI
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagtcgaaaatgattgtgcgcaccaaatttattgatcgcgcctgtcactggacc
gtggtgatttgcttcttcctggtggcgctgtccgggatttcgttcttcttcccgacgctg
caatggctgacgcaaaccttcggtacgccgcagatgggacgcattttgcacccgttcttc
ggcattgcgattttcgtcgcgctgatgtttatgtttgtgcgttttgtgcatcacaacatc
ccggataagaaagatattccgtggctgttgaacattgtcgaagtattaaaaggcaatgag
cacaaagtggcggatgtcggtaagtacaacgccgggcaaaagatgatgttctggtcgatc
atgagcatgattttcgtgctgctggtgaccggggtgattatctggcgtccgtactttgcg
cagtacttcccgatacaggttgtccgttatagcctgctgatccacgcggctgcgggtatc
atcctgatccacgccatcctgatccatatgtatatggcattctgggtgaaaggatcgatt
aaagggatgatcgaaggaaaggtgagccgtcgctgggcgaagaaacaccatccacgctgg
tatcgtgaaatcgagaaggcagaagcgaaaaaagagagtgaagaagggatataa

DBGET integrated database retrieval system