KEGG   Escherichia coli O44 H18 042 (EAEC): EC042_3686Help
Entry
EC042_3686        CDS       T02067                                 

Gene name
glpD
Definition
(GenBank) aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
elo  Escherichia coli O44:H18 042 (EAEC)
Pathway
elo00564  Glycerophospholipid metabolism
elo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:elo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    EC042_3686 (glpD)
Enzymes [BR:elo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     EC042_3686 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored Pyr_redox_2 NAD_binding_8 3HCDH_N FAD_binding_2 Lycopene_cycl GIDA
Motif
Other DBs
NCBI-ProteinID: CBG36511
UniProt: D3H042
LinkDB All DBs
Structure
PDB: 

Position
3908319..3909839
Genome map
AA seq 506 aa AA seqDB search
MNEGSMETKDLIVIGGGINGAGIAADAAGRGLSVLMLEAQDLACATSSASSKLIHGGLRY
LEHYEFRLVSEALAEREVLLKMAPHIAFPMRFRLPHRPHLRPAWMIRIGLFMYDHLGKRT
SLPGSTGLRFGANSVLKPEIKRGFEYSDCWVDDARLVLANAQMVVRKGGEVLTRTRATSA
RRENGLWIVEAEDIDTGKKYSWQARGLVNATGPWVKQFFDEGMHLPSPYGIRLIKGSHIV
VPRVHTQKQAYILQNEDKRIVFVIPWMDEFSIIGTTDVEYKGDPKAVKIEESEINYLLKV
YNTHFKKQLSRDDIVWTYSGVRPLCDDESDSPQAITRDYTLDIHDENGKAPLLSVFGGKL
TTYRKLAEHALEKLTPYYQGIGPAWTKESVLPGGAIEGDRDDYAARLRRRYPFLTESLAR
HYARTYGSNSELLLGNAGAISDLGEDFGHEFYEAELKYLVDHEWVRRADDALWRRTKQGM
WLNADQQSRVSQWLVEYTQQRLSLAS
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgagggcagcatggaaaccaaagatctgattgtgataggtggcggcatcaatggt
gctggtatcgcggcagacgccgctggacgcggtttatccgtgctgatgctggaggcgcag
gatctcgcttgtgcgacctcttccgccagttcaaaactcattcacggtggcctgcgctac
cttgagcactatgaattccgcctggtcagcgaggcgctggctgaacgtgaagtgctactg
aaaatggccccgcatatcgccttcccgatgcgttttcgcctgccgcatcgtccgcatctg
cgcccggcgtggatgattcggattggtctgtttatgtacgatcatctgggtaaacgcacc
agcctaccgggatcaaccggtttgcgttttggcgcaaattcagtattaaaaccggaaatt
aagcgcggattcgaatattccgactgttgggtagacgacgctcgtctggtactcgccaac
gcccagatggtggtgcgtaaaggcggtgaagtgcttacccgtactcgtgccacttctgct
cgccgcgaaaacggcctgtggattgtggaagcggaagatatcgataccggcaaaaaatat
agctggcaagcgcgcggcctcgtgaacgccaccggcccgtgggtgaaacagttcttcgac
gaggggatgcatctgccttcgccttatggcattcgcctgatcaaaggcagccatattgta
gtgccacgcgtacatacccagaagcaagcctacattctgcaaaacgaagataaacgtatt
gtgttcgtgatcccgtggatggacgagttttccatcatcggcaccaccgatgtggaatac
aaaggtgatccgaaagccgtgaagattgaagagagtgaaatcaattacctgctgaaagtg
tataacacgcactttaaaaagcagttaagccgggacgatatcgtctggacctactccggc
gtgcgtccgctatgtgatgatgagtccgactcgccgcaggctattactcgtgattacacg
cttgatatccatgatgaaaacggtaaagcgccgctgctgtcggtattcggcggtaagctg
acgacctaccgcaaactggcggaacatgcgctggaaaaactgacgccatattatcagggc
attggcccagcgtggacgaaagagagcgtgctaccgggtggagcaattgaaggcgaccgc
gatgactacgccgcccgcctgcgccgccgttacccattcctgaccgaatcgctggcacgt
cactacgcgcgcacctacggcagcaacagcgaactgctgctcggcaatgcgggggcgata
agcgacctcggggaggatttcggtcatgagttctacgaagcggaactgaaatacctggtg
gatcacgaatgggtccgccgtgccgacgatgccctgtggcgtcgcacaaaacaaggcatg
tggctgaatgcggatcaacaatctcgtgtgagtcagtggctagtggagtatacgcagcag
aggttatcgctggcttcgtga

DBGET integrated database retrieval system