KEGG   Escherichia coli O44 H18 042 (EAEC): EC042_4593A
Entry
EC042_4593A       CDS       T02067                                 

Gene name
set1B
Definition
(GenBank) enterotoxin 1
  KO
K11012  enterotoxin Set1B
Organism
elo  Escherichia coli O44:H18 042 (EAEC)
Brite
KEGG Orthology (KO) [BR:elo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:elo02042]
    EC042_4593A (set1B)
Bacterial toxins [BR:elo02042]
 Type III toxins: Intracellular toxins
  Others
   Enterotoxin ShET-1
    EC042_4593A (set1B)
SSDB
Other DBs
NCBI-ProteinID: CBG37420
UniProt: D3GV22
LinkDB
Position
4926658..4926843
AA seq 61 aa
MVQRNIPFILAPVIHGVRDRGTFLRNDIISCSVIFIHKCPVTSQCDMAVIRLNVTVQRGV
T
NT seq 186 nt   +upstreamnt  +downstreamnt
atggttcagcgtaatattcccttcatactggctcctgtcattcacggtgtccgggacaga
ggtaccttcctccggaatgacataatttcctgttccgtcatttttatccacaaatgccct
gtcacttcccagtgtgatatggctgttatccgacttaatgtcactgttcagcgaggcgtt
acgtga

DBGET integrated database retrieval system