KEGG   Escherichia coli O44 H18 042 (EAEC): EC042_4593B
Entry
EC042_4593B       CDS       T02067                                 

Gene name
set1A
Definition
(GenBank) enterotoxin 1
  KO
K11011  enterotoxin Set1A
Organism
elo  Escherichia coli O44:H18 042 (EAEC)
Brite
KEGG Orthology (KO) [BR:elo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:elo02042]
    EC042_4593B (set1A)
Bacterial toxins [BR:elo02042]
 Type III toxins: Intracellular toxins
  Others
   Enterotoxin ShET-1
    EC042_4593B (set1A)
SSDB
Motif
Pfam: PHD_2
Other DBs
NCBI-ProteinID: CBG37421
UniProt: D3GV23
LinkDB
Position
4926847..4927380
AA seq 177 aa
MEVSVFQRQCFHCKLTVFPVFLVQADRCTATDGGMDNRMSLEYQGATVLTQGTFRQVHAT
IKDDLSSPRHLWNGDIHIPGQLTMKDNGLFCPPGQDPIFYCLNCFVFVHANKLPLSRIIQ
AVPPQSVTIAGRFQNIEAGLAVEYHAVQVSWSAGTTKGGYISNRRFTDICILSLKIQ
NT seq 534 nt   +upstreamnt  +downstreamnt
atggaagtcagcgtctttcagcgacagtgttttcattgtaaactgacggttttcccagtc
tttctggttcaggctgaccggtgcactgccactgatggaggcatggataaccggatgtcc
ctggaatatcagggtgccactgtcctgactcagggtaccttccggcaggttcacgctacc
atcaaagatgacctttcttccccccggcacctgtggaatggcgacatccatattcccggt
cagctgaccatgaaagataacgggttgttttgcccgcccggccaggatcctatcttttac
tgtctgaactgctttgtttttgtccatgccaacaaactcccactgagccggatcattcag
gctgttcccccacagagtgttaccatagctggcagatttcagaatatagaagcgggtctg
gctgttgagtatcatgctgtacaggtttcctggagtgccggtaccaccaaagggggatat
atttccaatcgtcggttcactgacatttgtatcctgagccttaagatccagtaa

DBGET integrated database retrieval system