KEGG   Escherichia coli O44 H18 042 (EAEC): EC042_4856Help
Entry
EC042_4856        CDS       T02067                                 

Gene name
mdoB
Definition
(GenBank) phosphoglycerol transferase I (phosphatidylglycerol--membrane-oligosaccharide glycerophosphotransferase)
  KO
K01002  phosphoglycerol transferase [EC:2.7.8.20]
Organism
elo  Escherichia coli O44:H18 042 (EAEC)
Brite
KEGG Orthology (KO) [BR:elo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    EC042_4856 (mdoB)
Enzymes [BR:elo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.20  phosphatidylglycerol---membrane-oligosaccharide glycerophosphotransferase
     EC042_4856 (mdoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sulfatase PilN
Motif
Other DBs
NCBI-ProteinID: CBG37678
UniProt: D3GY00
LinkDB All DBs
Position
complement(5198419..5200710)
Genome map
AA seq 763 aa AA seqDB search
MSELLSFALFLASVLIYAWKAGRNTWWFAATLTVLGLFVVLNITLFASDYFTGDGINDAV
LYTLTNSLTGAGVSKYILPGIGIVLGLTAVFGALGWILHRRRHHPHHFGYSLLALLLALG
SVDASPAFRQITELVKSQSRDGDPDFAAYYKEPSKTIPDPKLNLVYIYGESLERTYFDNE
AFPDLTPELGALKNEGLDFSHTQQLPGTDYTIAGMVASQCGIPLFAPFEGNASASVSSFF
PQNICLGDILKNSGYQNYFVQGANLRFAGKDVFLKSHGFDHLYGSEELKSVVADPHYRND
WGFYDDTVLDEAWKKFEELSRSGQRFSLFTLTVDTHHPDGFISRTCNRKKYDFDGKPNQS
FSAVSCSQENIATFINKIKASPWFKDTVIVVSSDHLAMNNTAWKYLNKQDRNNLFFVIRG
DKPQQETLAVKRNTMDNGATVLDILGGDNYLGLGRSSLSGQSMSEIFLNIKEKTLAWKPD
IIRLWKFPKEMKEFTIDQQKNMIAFSGSHFRLPLLLRVSDKRVEPLPESEYSAPLRFQLA
DFAPRDNFVWVDRCYKMAQLWAPELALSTDWCVSQGQLGGQQIVQHVDKTTWQGKTAFKD
TVIDMARYKGNVDTLKIVDNDIRYKADSFIFNVAGAPEEVKQFSGISRPESWGRWSNAQL
GDEVKIEYKHPLPKKFDLVITAKAYGNNASRPIPVRVGNEEQTLVLGNEVTTTTLHFDNP
TDADTLVIVPPEPVSTNEGNILGHSPRKLGIGMVEIKVVEREG
NT seq 2292 nt NT seq  +upstreamnt  +downstreamnt
ttgtcagaactactctctttcgccctttttctcgcctctgtgctgatttacgcatggaaa
gcgggacgtaacacctggtggtttgcagccacgttaacggtgctggggctatttgtcgtt
ttaaatatcaccctgtttgccagcgactattttactggcgatggtattaacgacgcggtt
ctctataccttaaccaacagcctgaccggtgctggtgtcagcaaatacattcttccgggt
atcggcattgtgctggggctgacggcggtgttcggtgcgctgggctggatcctgcaccgt
cgtcgccatcatccgcaccattttggttacagcctgctggcactcttactggcgctgggt
tcagtggatgccagcccggcatttcgtcagataacggaactggtgaaatcccagtcacgc
gacggcgacccggactttgcggcttattataaagagccgtcgaaaactatccctgacccg
aaactcaacctggtttatatctacggcgaaagtctcgagcgaacctattttgataacgaa
gctttcccggatctcacgcctgaactgggcgcgttgaaaaatgaaggcctggatttcagc
cacacgcagcagctgccaggaacggattacacgattgcgggcatggtggcttctcagtgc
ggcataccgctgtttgccccctttgaaggcaacgcctccgcctctgtctccagcttcttc
ccgcagaacatctgtctgggcgatatcctgaaaaactcgggttatcagaactatttcgtg
cagggcgcaaatctgcgttttgccggtaaagatgtgttcctgaaatcgcacggcttcgac
cacttatacggctcagaagagctgaaaagcgtggtagccgacccgcactatcgcaacgac
tggggattctacgacgataccgttctcgatgaagcgtggaaaaagtttgaagagctttcc
cgctcaggtcagcgattctcactgtttaccctgacagtcgatacccatcacccggatggt
tttatttctcgtacctgtaaccgcaaaaaatatgattttgacggtaaaccgaatcagtca
ttcagcgcggtaagttgcagccaggagaatatcgcgacgtttatcaacaaaatcaaagcg
tcaccgtggtttaaagatactgtcatcgtcgtctcttctgaccatttagcgatgaacaac
acggcgtggaaatacctcaataagcaggatcgcaataacctgttttttgtcattcgtggc
gacaagccgcagcaagagacgctggcagtgaagcgtaacacgatggataacggcgcgacg
gtgctggacattctcggtggcgataactatctcggacttggtcgtagcagtttatccggg
cagtcgatgtcggaaatcttcctcaatatcaaagagaaaacattggcgtggaagccagat
atcatccgcctgtggaaattccctaaagagatgaaagagttcaccatcgaccagcagaaa
aacatgattgccttctcgggtagccatttccgtttgccgctgctgttgcgggtttcagac
aaacgcgtggaaccgctgccggaaagcgaatactcagcaccgctgcgtttccagctggcc
gatttcgctccacgcgacaatttcgtctgggttgaccgttgctataagatggcacaactc
tgggctccggaactggcactctccaccgactggtgtgtctcgcaagggcagcttggcggt
cagcaaattgttcagcatgttgacaaaacaacatggcagggcaaaacggcatttaaagat
acggtcatcgacatggcgcgttataaaggcaatgtcgatacgctgaaaattgttgataac
gatattcgctacaaagccgacagtttcatcttcaacgtcgccggtgcgccagaagaggtg
aaacagtttagtgggatttcccgtccagagtcgtggggccgctggtccaacgcgcagctg
ggcgatgaagtaaaaatcgagtacaagcatccgctgccgaagaaatttgacctggtgatt
accgccaaagcatacggcaataacgccagccgtcctattccggtacgcgtaggcaatgaa
gaacaaactcttgtgctgggcaatgaagtgaccaccaccacactgcatttcgataaccca
accgatgccgacacactggtaattgtgccaccggaacctgtctcaaccaacgaagggaat
atcctcggacactcgccgcgtaagctcgggatcggcatggtggaaattaaagttgtggaa
cgtgaagggtaa

DBGET integrated database retrieval system