KEGG   Escherichia coli P12b: P12B_c0399Help
Entry
P12B_c0399        CDS       T02030                                 

Gene name
phoA
Definition
(GenBank) Alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
elp  Escherichia coli P12b
Pathway
elp00730  Thiamine metabolism
elp00790  Folate biosynthesis
elp01100  Metabolic pathways
elp02020  Two-component system
Module
elp_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:elp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    P12B_c0399 (phoA)
   00790 Folate biosynthesis
    P12B_c0399 (phoA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    P12B_c0399 (phoA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:elp04147]
    P12B_c0399 (phoA)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:elp00537]
    P12B_c0399 (phoA)
Enzymes [BR:elp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     P12B_c0399 (phoA)
Exosome [BR:elp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   P12B_c0399 (phoA)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:elp00537]
 Enzymes
  P12B_c0399 (phoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase Phosphodiest
Motif
Other DBs
NCBI-ProteinID: AFG39282
LinkDB All DBs
Structure
PDB: 

Position
422053..423393
Genome map
AA seq 446 aa AA seqDB search
MPVLENRAAQGDITAPGGARRLTGDQTAALRDSLSDKPAKNIILLIGDGMGDSEITAARN
YAEGAGGFFKGIDALPLTGQYTHYALNKKTGKPDYVTDSAASATAWSTGVKTYNGALGVD
IHEKDHPTILEMAKAAGLATGNVSTAELQDATPAALVAHVTSRKCYGPSATSEKCPGNAL
EKGGKGSITEQLLNARADVTLGGGAKTFAETATAGEWQGKTLREQAQARGYQLVSDAASL
NSVTEANQQKPLLGLFADGNMPVRWLGPKATYHGNIDKPAVTCTPNPQRNDSVPTLAQMT
DKAIELLSKNEKGFFLQVEGASIDKQDHAANPCGQIGETVDLDEAVQRALEFAKKEGNTL
VIVTADHAHASQIVAPDTKAPGLTQALNTKDGAVMVMSYGNSEEDSQEHTGSQLRIAAYG
PHAANVVGLTDQTDLFYTMKAALGLK
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgcctgttctggaaaaccgggctgctcagggcgatattactgcacccggcggtgctcgc
cgtttaacgggtgatcagactgccgctctgcgtgattctcttagcgataaacctgcaaaa
aatattattttgctgattggcgatgggatgggggactcggaaattactgccgcacgtaat
tatgccgaaggtgcgggcggcttttttaaaggtatagatgccttaccgcttaccgggcaa
tacactcactatgcgctgaataaaaaaaccggcaaaccggactacgtcaccgactcggct
gcatcagcaaccgcctggtcaaccggtgtcaaaacctataacggcgcgctgggcgtcgat
attcacgaaaaagatcacccaacgattctggaaatggcaaaagccgcaggtctggcgacc
ggtaacgtttctaccgcagagttgcaggatgccacgcccgctgcgctggtggcacatgtg
acctcgcgcaaatgctacggtccgagcgcgaccagtgaaaaatgtccgggtaacgctctg
gaaaaaggcggaaaaggatcgattaccgaacagctgcttaacgctcgtgccgacgttacg
cttggcggcggcgcaaaaacctttgctgaaacggcaaccgctggtgaatggcagggaaaa
acgctgcgtgaacaggcacaggcgcgtggttatcagttggtgagcgatgctgcctcactg
aattcggtgacggaagcgaatcagcaaaaacccctgcttggcctgtttgctgacggcaat
atgccagtgcgctggctaggaccgaaagcaacgtaccatggcaatatcgataagcccgca
gtcacctgtacgccaaatccgcaacgtaatgacagtgtaccaaccctggcgcagatgacc
gacaaagccattgaattgttgagtaaaaatgagaaaggctttttcctgcaagttgaaggt
gcgtcaatcgataaacaggatcatgctgcgaatccttgtgggcaaattggcgagacggtc
gatctcgatgaagccgtacaacgggcgctggaattcgctaaaaaggagggtaacacgctg
gtcatagtcaccgctgatcacgcccacgccagccagattgttgcgccggataccaaagct
ccgggcctcacccaggcgctaaataccaaagatggcgcagtgatggtgatgagttacggg
aactccgaagaggattcacaagaacataccggcagtcagttgcgtattgcggcgtatggc
ccgcatgccgccaatgttgttggactgaccgaccagaccgatctcttctacaccatgaaa
gccgctctggggctgaaataa

DBGET integrated database retrieval system