KEGG   Escherichia coli P12b: P12B_c0718Help
Entry
P12B_c0718        CDS       T02030                                 

Gene name
galM
Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
elp  Escherichia coli P12b
Pathway
elp00010  Glycolysis / Gluconeogenesis
elp00052  Galactose metabolism
elp01100  Metabolic pathways
elp01110  Biosynthesis of secondary metabolites
elp01120  Microbial metabolism in diverse environments
elp01130  Biosynthesis of antibiotics
Module
elp_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:elp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    P12B_c0718 (galM)
   00052 Galactose metabolism
    P12B_c0718 (galM)
Enzymes [BR:elp01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     P12B_c0718 (galM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AFG39594
LinkDB All DBs
Position
complement(784227..785192)
Genome map
AA seq 321 aa AA seqDB search
MVVTLMDWGATLLSARIPLSDGSVREALLGCASPECYQDQAAFLGASIGRYANRIANSRY
TFDGETVTLSPSQGVNQLHGGPEGFDKRRWQIVNQNDRQVLFALSSDDGDQGFPGNLGAT
VQYRLTDDNRISITYRATVDKPCPVNMTNHVYFNLDGEQSDVRNHKLQILADEYLPVDEG
GIPHDGLKSVAGTSFDFRSAKIIASEFLADDDQRKVKGYDHAFLLQAKGDGKKVAAHVWS
ADEKLQLKVYTTAPALQFYSGNFLGGTPSRGTEPYADWQGLALESEFLPDSPNHPEWPQP
DCFLRPGEEYSSLTEYQFIAE
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggtagtcacgctgatggactggggtgcgactttactttccgcccgtattccgctttcc
gatggcagcgtccgcgaggcgctgctcggctgtgccagcccggaatgctatcaggatcag
gccgcgtttctgggggcctctattggtcgttatgccaaccgtatcgccaatagccgttat
acctttgacggtgaaaccgtgacgctttcgccaagtcagggcgttaaccagctgcacggc
gggccggaagggttcgacaaacgtcgctggcagattgtgaaccagaacgatcgtcaggtg
ctgtttgccctgagttcagatgatggtgatcagggcttcccgggtaatctcggcgcgacg
gtgcaatatcgtctgaccgacgataaccgtatctccattacttatcgcgccacagttgat
aaaccttgcccggtgaatatgactaatcacgtctatttcaatcttgacggcgagcagtct
gacgtgcgcaatcacaagttgcagattctggcggacgaatatctgccggttgatgaaggc
ggcattccgcacgacggcctgaaatctgtcgccggaacgtcttttgatttccgcagcgcc
aaaatcatcgccagtgagtttcttgccgacgacgatcagcgcaaagtgaaaggttacgat
cacgcattcttgttacaggccaaaggcgatggcaagaaagtggcggcgcatgtctggtca
gcagatgaaaaattgcagctgaaggtctacaccaccgctccggctctgcaattctactcc
ggcaacttcctcggcggcacaccgtcgcggggaaccgaaccttacgccgactggcaaggg
ctggctctggaaagcgagtttctaccggacagcccgaaccaccctgaatggccgcaaccg
gactgcttcctgcgtcctggcgaagagtattccagcctgacggaatatcagtttattgct
gagtaa

DBGET integrated database retrieval system