KEGG   Escherichia coli P12b: P12B_c1439Help
Entry
P12B_c1439        CDS       T02030                                 

Gene name
slyA
Definition
(GenBank) Transcriptional regulator
  KO
K06075  MarR family transcriptional regulator, transcriptional regulator for hemolysin
Organism
elp  Escherichia coli P12b
Brite
KEGG Orthology (KO) [BR:elp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:elp03000]
    P12B_c1439 (slyA)
Transcription factors [BR:elp03000]
 Prokaryotic Type
  Helix-turn-helix
   MarR family
    P12B_c1439 (slyA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR HTH_27 MarR_2 HTH_Crp_2 HTH_20 B-block_TFIIIC HxlR HTH_24 TrmB HTH_5 HTH_36 Replic_Relax LexA_DNA_bind GntR RP-C GlnD_UR_UTase DUF2250 Fe_dep_repress
Motif
Other DBs
NCBI-ProteinID: AFG40302
LinkDB All DBs
Position
1557153..1557554
Genome map
AA seq 133 aa AA seqDB search
MVRIWRALIDHRLKPLELTQTHWVTLHNIHQLPPDQSQIQLAKAIGIEQPSLVRTLDQLE
EKGLISRQTCASDRRAKRIKLTEKAEPLISEMEAVINKTRAEILHGISAEELEQLITLIA
KLEHNIIELQAKG
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
ttggtgcgcatatggcgtgctctgatagaccatcgcctgaaaccgctggagttaacacaa
acccattgggttacgttacacaatatccatcagttacctccagaccagtcgcaaattcaa
ctggcaaaagcgattggcatcgagcagccatcactggtccgtactctggaccaactggaa
gaaaaagggttaatttcgcgtcaaacttgtgccagcgatcgtcgggctaaacgtattaaa
ctgacggaaaaggcagagccactgatcagcgaaatggaagctgttattaacaaaacccgc
gcggaaatattacatggcatctccgcagaggaactggaacaactgattacgctcatcgca
aaacttgagcataatatcattgagttacaggccaaagggtga

DBGET integrated database retrieval system