KEGG   Escherichia coli P12b: P12B_c2012Help
Entry
P12B_c2012        CDS       T02030                                 

Gene name
fabF
Definition
(GenBank) 3-oxoacyl-[acyl-carrier-protein] synthase 2
  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Organism
elp  Escherichia coli P12b
Pathway
elp00061  Fatty acid biosynthesis
elp00780  Biotin metabolism
elp01100  Metabolic pathways
elp01212  Fatty acid metabolism
Module
elp_M00083  Fatty acid biosynthesis, elongation
elp_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:elp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    P12B_c2012 (fabF)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    P12B_c2012 (fabF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:elp01004]
    P12B_c2012 (fabF)
Enzymes [BR:elp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.179  beta-ketoacyl-[acyl-carrier-protein] synthase II
     P12B_c2012 (fabF)
Lipid biosynthesis proteins [BR:elp01004]
 Fatty acid synthase
  Component type
   P12B_c2012 (fabF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N ACP_syn_III KAsynt_C_assoc
Motif
Other DBs
NCBI-ProteinID: AFG40861
LinkDB All DBs
Structure
PDB: 

Position
complement(2185238..2186443)
Genome map
AA seq 401 aa AA seqDB search
MLSPVGNTVESTWKALLAGQSGISLIDHFDTSAYATKFAGLVKDFNCEDIISRKEQRKMD
AFIQYGIVAGVQAMQDSGLEITEENATRIGAAIGSGIGGLGLIEENHTSLMNGGPRKISP
FFVPSTIVNMVAGHLTIMYGLRGPSISIATACTSGVHNIGHAARIIAYGDADVMVAGGAE
KASTPLGVGGFGAARALSTRNDNPQAASRPWDKERDGFVLGDGAGMLVLEEYEHAKKRGA
KIYAELVGFGMSSDAYHMTSPPENGAGAALAMANALRDAGIEASQIGYVNAHGTSTPAGD
KAEAQAVKTIFGEAASRVLVSSTKSMTGHLLGAAGAVESIYSILALRDQAVPPTINLDNP
DEGCDLDFVPHEARQVSGMEYTLCNSFGFGGTNGSLIFKKI
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgttgtctcctgtcggcaataccgtagagtctacctggaaagctctgcttgccggtcag
agtggcatcagcctaatcgaccatttcgatactagcgcctatgcaacgaaatttgctggc
ttagtaaaggattttaactgtgaggacattatctcgcgcaaagaacagcgcaagatggat
gccttcattcaatatggaattgtcgctggcgttcaggccatgcaggattctggccttgaa
ataacggaagagaacgcaacccgcattggtgccgcaattggctccgggattggcggcctc
ggactgatcgaagaaaaccacacatctctgatgaacggtggtccacgtaagatcagccca
ttcttcgttccgtcaacgattgtgaacatggtggcaggtcatctgactatcatgtatggc
ctgcgtggcccgagcatctctatcgcgactgcctgtacttccggcgtgcacaacattggc
catgctgcgcgtattatcgcgtatggcgatgctgacgtgatggttgcaggtggcgcagag
aaagccagtacgccgctgggcgttggtggttttggcgcggcacgtgcattatctacccgc
aatgataacccgcaagcggcgagccgcccgtgggataaagagcgtgatggtttcgtactg
ggcgatggtgccggtatgctggtacttgaagagtacgaacacgcgaaaaaacgcggtgcg
aaaatttacgctgaactcgtcggctttggtatgagcagcgatgcttatcatatgacgtca
ccgccagaaaatggcgcaggcgcagctctggcgatggcaaatgctctgcgtgatgcaggc
attgaagcgagtcagattggctacgttaacgcgcacggtacttctacgccggctggcgat
aaagctgaagcgcaggcggtgaaaaccatcttcggtgaagctgcaagccgtgtgttggta
agctccacgaaatctatgaccggtcacctgttaggtgcggcgggtgcagtagaatctatc
tactccatcctggcgctgcgcgatcaggctgttccgccaaccatcaacctggataacccg
gatgaaggttgcgatctggatttcgtaccgcacgaagcgcgtcaggttagcggaatggaa
tacactctgtgtaactccttcggcttcggtggcactaatggttctttgatctttaaaaag
atctaa

DBGET integrated database retrieval system