KEGG   Escherichia coli P12b: P12B_c2256Help
Entry
P12B_c2256        CDS       T02030                                 

Gene name
rihB
Definition
(GenBank) Inosine-uridine preferring nucleoside hydrolase family protein
  KO
K10213  ribosylpyrimidine nucleosidase [EC:3.2.2.8]
Organism
elp  Escherichia coli P12b
Pathway
elp00230  Purine metabolism
elp00240  Pyrimidine metabolism
elp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:elp00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    P12B_c2256 (rihB)
   00240 Pyrimidine metabolism
    P12B_c2256 (rihB)
Enzymes [BR:elp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.8  ribosylpyrimidine nucleosidase
     P12B_c2256 (rihB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IU_nuc_hydro
Motif
Other DBs
NCBI-ProteinID: AFG41101
LinkDB All DBs
Structure
PDB: 

Position
complement(2443065..2444006)
Genome map
AA seq 313 aa AA seqDB search
MEKRKIILDCDPGHDDAIAMMMAAKHPAIDLLGITIVAGNQTLDKTLINGLNVCQKLEIN
VPVYAGMPQPIMRQQIVADNIHGETGLDGPVFEPLTRQAESTHAVKYIIDTLMASDGDIT
LVPVGPLSNIAVAMRMQPAILPKIREIVLMGGAYGTGNFTPSAEFNIFADPEAARVVFTS
GVPLVMMGLDLTNQTVCTPDVIARMERAGGPAGELFSDIMNFTLKTQFENYGLAGGPVHD
ATCIGYLINPDGIKTQEMYVEVDVNSGPCYGRTVCDELGVLGKPANTKVGITIDTDWFWG
LVEECVRGYIKTH
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagagaaaaattattctggattgtgatccgggtcatgatgatgctattgcaatg
atgatggcagcgaaacatccggcaatagatttattaggcatcactattgtagcgggtaat
cagacgcttgataaaacattaattaatggcctgaatgtttgccagaaactggagattaat
gttccggtttatgcggggatgccgcagcccattatgcgtcaacaaatcgttgccgataat
attcacggtgaaaccggactggatggcccggtattcgagccgctgacccgccaggcagaa
agtacccatgcggtgaaatacatcattgataccctgatggcaagcgatggcgatatcact
ctggtgccggttggtccgctttcaaatatcgcggtggcaatgcgtatgcaacccgcgatc
ctgcccaaaatccgtgaaattgtgctaatgggcggcgcttacggtacaggcaacttcacc
ccatctgctgagttcaacatctttgctgacccggaggccgcacgcgtggtgttcacctcc
ggcgttccattagtgatgatgggcctcgatcttaccaaccagaccgtttgcaccccggat
gtgattgctcggatggaaagggctggcggccctgccggagagctgttcagcgacatcatg
aacttcactctcaaaacgcagttcgaaaactacggcctggctggcggcccggtgcacgac
gccacctgcatcggttatttgattaaccctgatggcattaaaacccaggagatgtacgtc
gaagtggacgttaacagtggcccttgctatgggcgtaccgtctgcgacgagctgggcgtt
cttggcaagcccgccaataccaaagtcggcatcactattgataccgactggttctgggga
ttagtcgaagagtgcgtacgtggctacataaaaacccattaa

DBGET integrated database retrieval system